KEGG   Salinibacter ruber DSM 13855: SRU_1125Help
Entry
SRU_1125          CDS       T00312                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00020  Citrate cycle (TCA cycle)
sru00640  Propanoate metabolism
sru00660  C5-Branched dibasic acid metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01130  Biosynthesis of antibiotics
sru01200  Carbon metabolism
Module
sru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SRU_1125
   00640 Propanoate metabolism
    SRU_1125
   00660 C5-Branched dibasic acid metabolism
    SRU_1125
Enzymes [BR:sru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SRU_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 3850809
NCBI-ProteinID: YP_445252
UniProt: Q2S3H9
Position
1416928..1418106
Genome map
AA seq 392 aa AA seqDB search
MKLHEYQAKGLFRDYGVSVPDGIVAETVDAAVDAARRLEEENDATLFIVKAQIHAGGRGK
GGGVKLAHSVEEVREHADNILGMDLVTHQTGPEGQTVRKILVTEGVDIDQEYYLGVTLDR
ETSMNAIMVSTEGGVDIETVAEESPEKIQRVWVDPSIGLRPFQTRQLAFAMGLEGDAFKQ
AVASIQGLYEAFEENDCTLAEINPLVQTPGGDIEAVDAKVNLDDNALFRHPDLEEMRDLH
EEDPTEVKAGEHGLSYITLDGNVGCMVNGAGLAMATMDIIKLAGGEPANFLDVGGAASAE
TVEAGFRIILEDPNVEALLLNIFGGIVRCDRVAQGVIEAAKNIDIDVPLIVRLQGTNAEE
GKRLLDESDLSLRSAVLLKEAADEVTAALGED
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgaataccaagcaaaaggtctctttcgcgactacggcgtatcggttccg
gacggcatcgtggccgagacggtcgacgcggccgtcgacgcggcgcgccggctggaggag
gagaacgacgccaccctgtttatcgtgaaggcgcagatccatgccggcgggcgcggcaag
gggggcggcgtcaagctcgcccacagcgtcgaggaggtccgcgagcacgccgacaacatc
ttgggcatggacctggtgacccaccagaccggcccggagggccagacggtccgcaagatt
ctcgtaaccgagggcgtcgacatcgatcaggagtactacctgggcgtcaccctggaccgg
gagacgagcatgaacgccatcatggtgtcgaccgagggcggcgtcgacatcgagacggtc
gcggaggagtcccccgagaagattcagcgggtgtgggtggacccgtcgattggcctgcgg
ccgttccagacccgccagctcgcgttcgccatggggctggagggcgatgccttcaagcag
gccgtcgcgtcgattcagggcctgtacgaagcgttcgaagagaacgactgcacgctcgcc
gagatcaacccgctcgtgcagacgcccggcggcgacatcgaggccgtcgacgcgaaggtg
aacctcgacgacaacgcgctcttccgccacccggacctggaagagatgcgcgacctccac
gaagaggacccgacggaggtgaaggccggcgagcacggcctgagctacatcacgctcgac
ggcaacgtgggctgcatggtcaacggcgccggcctcgccatggcgacgatggacatcatc
aagctggcgggcggggagcctgcaaacttcctcgacgtgggcggggcggcaagtgccgag
acggtggaggcgggcttccgcatcattctggaggacccgaacgtggaggccctgctcctc
aacatcttcggcggcatcgtgcggtgcgaccgcgtggcccagggcgtcatcgaggcggcc
aagaacatcgacatcgacgtgccgctgatcgtccgcctgcagggcaccaacgccgaggag
ggcaagcgcctgctcgacgagagtgacctgtcgctccggtcggcggtcctgctgaaggag
gcggccgacgaggtgaccgcggcgctgggggaagactag

DBGET integrated database retrieval system