KEGG   Salinibacter ruber DSM 13855: SRU_1125Help
Entry
SRU_1125          CDS       T00312                                 

Definition
succinyl-CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRU_1125
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SRU_1125
   00640 Propanoate metabolism
    SRU_1125
   00660 C5-Branched dibasic acid metabolism
    SRU_1125
Enzymes [BR:sru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SRU_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1416928..1418106
Genome map
AA seq 392 aa AA seqDB search
MKLHEYQAKGLFRDYGVSVPDGIVAETVDAAVDAARRLEEENDATLFIVKAQIHAGGRGK
GGGVKLAHSVEEVREHADNILGMDLVTHQTGPEGQTVRKILVTEGVDIDQEYYLGVTLDR
ETSMNAIMVSTEGGVDIETVAEESPEKIQRVWVDPSIGLRPFQTRQLAFAMGLEGDAFKQ
AVASIQGLYEAFEENDCTLAEINPLVQTPGGDIEAVDAKVNLDDNALFRHPDLEEMRDLH
EEDPTEVKAGEHGLSYITLDGNVGCMVNGAGLAMATMDIIKLAGGEPANFLDVGGAASAE
TVEAGFRIILEDPNVEALLLNIFGGIVRCDRVAQGVIEAAKNIDIDVPLIVRLQGTNAEE
GKRLLDESDLSLRSAVLLKEAADEVTAALGED
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgaataccaagcaaaaggtctctttcgcgactacggcgtatcggttccg
gacggcatcgtggccgagacggtcgacgcggccgtcgacgcggcgcgccggctggaggag
gagaacgacgccaccctgtttatcgtgaaggcgcagatccatgccggcgggcgcggcaag
gggggcggcgtcaagctcgcccacagcgtcgaggaggtccgcgagcacgccgacaacatc
ttgggcatggacctggtgacccaccagaccggcccggagggccagacggtccgcaagatt
ctcgtaaccgagggcgtcgacatcgatcaggagtactacctgggcgtcaccctggaccgg
gagacgagcatgaacgccatcatggtgtcgaccgagggcggcgtcgacatcgagacggtc
gcggaggagtcccccgagaagattcagcgggtgtgggtggacccgtcgattggcctgcgg
ccgttccagacccgccagctcgcgttcgccatggggctggagggcgatgccttcaagcag
gccgtcgcgtcgattcagggcctgtacgaagcgttcgaagagaacgactgcacgctcgcc
gagatcaacccgctcgtgcagacgcccggcggcgacatcgaggccgtcgacgcgaaggtg
aacctcgacgacaacgcgctcttccgccacccggacctggaagagatgcgcgacctccac
gaagaggacccgacggaggtgaaggccggcgagcacggcctgagctacatcacgctcgac
ggcaacgtgggctgcatggtcaacggcgccggcctcgccatggcgacgatggacatcatc
aagctggcgggcggggagcctgcaaacttcctcgacgtgggcggggcggcaagtgccgag
acggtggaggcgggcttccgcatcattctggaggacccgaacgtggaggccctgctcctc
aacatcttcggcggcatcgtgcggtgcgaccgcgtggcccagggcgtcatcgaggcggcc
aagaacatcgacatcgacgtgccgctgatcgtccgcctgcagggcaccaacgccgaggag
ggcaagcgcctgctcgacgagagtgacctgtcgctccggtcggcggtcctgctgaaggag
gcggccgacgaggtgaccgcggcgctgggggaagactag

DBGET integrated database retrieval system