KEGG   Salinibacter ruber DSM 13855: SRU_1215Help
Entry
SRU_1215          CDS       T00312                                 

Gene name
hemG
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00860  Porphyrin and chlorophyll metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
Module
sru_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SRU_1215 (hemG)
Enzymes [BR:sru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SRU_1215 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SRU_1215 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO FAD_oxidored Pyr_redox_2 HI0933_like FAD_binding_3 GIDA NAD_binding_9 Thi4 Pyr_redox ApbA Pyr_redox_3 3HCDH_N MCRA
Motif
Other DBs
NCBI-GeneID: 3852421
NCBI-ProteinID: YP_445341
UniProt: Q2S390
Position
complement(1532068..1533453)
Genome map
AA seq 461 aa AA seqDB search
MPNVGIIGAGISGLAAAYRLQEHGHSVRLLEASGHTGGVIRSESSEGFLVEHGPNSIRAG
AAGLETLIDALDLHEDRVWANDAADTRYVVRDGRPTPLPRSVGSFLTTDLFSTRAKLRLL
AEPFIGRAAAEEESVARFTERRLGPEVLNYAVAPFVGGVFAGRPDDLSVQHAFRRLAALE
EESGSLLLGAIRRALTSDDGAPPDTPSGLFSFRNGLQTLPNALADTLGDRIRLNAPVHAL
AHDGTAWRVTVSPPDAPAHTRSFDALVCTVPLHRLAAMEIDTPVDLAPLGEVTYPPLSVL
ALGYGRDAIDHALDGFGMLVPPVEDTLDVLGTIFSSTLFPGRAPEGHVLLTTFVGGARAP
HHATSDAAALQARVARDLDSLLGVDASPVFRRLVHWPHAIPQYELGYGTVKDTFDALEAA
HPHLAFAGNYRAGVSVGDALTSGLEAADRLLETDERAAQPH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgtcgggatcatcggagccggcatcagcggcctcgcggccgcgtaccgactt
caagagcacggccattcggttcgccttctggaagcctccgggcacacggggggcgtgatc
cgctcggagtcgtcggagggcttcctggtggagcacggccccaactcgatccgggccggg
gccgccggtctggagacgctgatcgacgccctcgacctccacgaggaccgcgtctgggcc
aacgacgcggccgatacccggtacgtggtgcgcgacggccgacctacacccctgcctcgc
tccgtcggctctttcctcacgaccgatttgttctcgacccgggcgaagttgcgcctcctg
gcggagcccttcatcggacgggccgcggcggaggaggagagcgtggcccggttcacggag
cggcgcctgggccccgaggtgctcaactatgccgtcgcccccttcgtggggggcgtgttc
gcggggaggcccgacgacctgtcggtccagcatgccttccgtcgcctcgccgcgctcgaa
gaagagtccggctccctcctcctcggcgcaatccgacgggccttgaccagcgacgacggt
gcccccccggacactccgtcgggcctcttctccttccgcaacggcctgcagacgctcccc
aacgcactggccgacacgctcggcgaccgcatccgcctgaacgcccccgtccacgccctc
gcgcacgacggcaccgcgtggcgggtgacggtctcgcccccggatgcccccgcacacacc
cgctccttcgacgccctcgtctgcaccgtgccgctccatcggctcgccgcgatggagatc
gacacccccgtcgatcttgcgccccttggggaggtgacctatcccccgctgagtgtgctt
gccctcggctacgggcgagacgccatcgaccacgccctcgatggattcgggatgctcgtg
ccgccggtggaggacacgttggacgtcctcgggaccatcttttcctccacgctcttcccc
ggccgcgccccggaggggcacgtgcttctcaccaccttcgtcggtggcgcacgcgccccc
caccacgccacgtccgacgcggcggcccttcaggcccgcgtggcccgcgacctggattca
ctcctcggtgtggatgcgtcgccggtgtttcggcgcctcgtccactggccccatgccatt
ccgcagtacgagctcgggtacggaacggtcaaagacacatttgacgccctggaggcggcc
caccctcaccttgcctttgccggcaactaccgggcgggcgtatcggtgggcgatgcgctt
acctccggcctggaggcggccgaccgcctgctcgagacggacgagcgggccgcgcagcct
cactga

DBGET integrated database retrieval system