KEGG   Salinibacter ruber DSM 13855: SRU_1252Help
Entry
SRU_1252          CDS       T00312                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00330  Arginine and proline metabolism
sru00332  Carbapenem biosynthesis
sru01100  Metabolic pathways
sru01130  Biosynthesis of antibiotics
sru01230  Biosynthesis of amino acids
Module
sru_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SRU_1252 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SRU_1252 (proB)
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SRU_1252 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 3851194
NCBI-ProteinID: YP_445376
UniProt: Q2S355
Position
1570464..1571594
Genome map
AA seq 376 aa AA seqDB search
MATVALPDWTRAVVKVGSALVAPDDRGCSTTHLLPIARFVIQSRRQGKEVILVSSGAVAA
GLAEQGRGGPGTGLSIPERQALAALGQPLLMAHWRRLFDVPCAQVLLTYDDLQRRARFVN
AKNTIAELLDRDTLPIVNENDTVATEELRVGDNDNLAAYVAVLAEADLLVICSDVDGLYT
ADPHDDPDAERLPAVDAITDEIYDMVGPSHRKVATGGMQTKVEAAEKATDRGIDTVLVNG
TKGGHLDALGRGEMPGTLFRQAEQPLPARKHWMLHALPSAGRLTVDAGAADALRHEGASL
LPSGIVAVEGRFARGDAVEIAVEKEGNRTRVAKGITQYGAADLERIQGRQSHAIAEVLDE
APADYVVHRDDLVVEA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgttgcgctcccggactggacccgtgccgtcgtgaaggtgggcagcgcgctc
gttgcgcccgacgatcggggctgcagcacgacgcacctgttgcccattgcgcgctttgta
attcagagccgtcggcagggcaaggaggtgattctggtctcctccggcgccgtggccgcc
gggctcgccgagcagggccggggcgggccgggcacgggcctctccatcccggagcggcag
gccctcgccgcgctcggccagccgctgctgatggcccattggcgccgtctcttcgacgtg
ccctgtgcgcaggtcctgctcacctacgacgacctgcagcgccgcgcccgcttcgtgaac
gcgaagaacacgatcgccgagttgctcgaccgggacacgctgccgatcgtgaatgaaaac
gacaccgtcgccaccgaggaattgcgggtgggcgacaacgacaacctcgccgcctacgtg
gcggtgctggccgaggcggatttgctcgtgatctgctcggacgtagacggcctctacacc
gccgatccgcacgacgacccggacgcggagcgcctgccggcggtggacgccatcaccgac
gagatctacgacatggtcgggccctcccaccgcaaggtggccaccggcggcatgcagacg
aaggtggaggcggcagaaaaagcgacggaccgcgggatcgataccgttctggtcaacgga
accaaaggcggccacctcgacgcgctggggcgcggtgagatgccgggcacgctctttcgg
caggccgagcagccgcttcccgcgcgcaagcactggatgctccacgcgcttccctccgcg
ggccgcctgacggtcgacgccggggcggccgacgcactgcgacacgagggcgcttcgttg
ttgccgtcgggcattgtggcggtggagggccgctttgcccggggcgacgccgtggagatt
gcagtcgagaaagaggggaaccggacccgcgtggcgaagggcatcacgcagtacggggcc
gccgacctggagcgcatccaggggcgacagagccacgccatcgccgaggtcctcgacgag
gcgcccgccgactacgtggtgcaccgcgacgatctggtggtggaggcgtga

DBGET integrated database retrieval system