KEGG   Salinibacter ruber DSM 13855: SRU_1457Help
Entry
SRU_1457          CDS       T00312                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sru00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1814673..1815299
Genome map
AA seq 208 aa AA seqDB search
MDALLIVDLQNDFCPGGALAVPEGDTIVPTVNAMAARFDHVIQTQDWHPAGHQSFASSHP
DHAPMDVIEVDYGEQVLWPDHCVQGTEGAEFHPDLDTAPSELILRKGFRPGIDSYSAFYE
NDGTTPTGLTGYLRERGIDTLYLCGLATDFCVKWSAVDGREEGFDVYVIEDATRGIDQDG
SLAQAWDEMNEAGVQVISSEAALDLAAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacgcactcctcatcgtcgaccttcaaaacgacttttgtcccggcggcgccctggcg
gtgccggagggggacaccatcgtcccgaccgtgaatgcgatggccgcccggttcgaccac
gtcatccagacccaggactggcacccggccggccaccagtcgttcgcctcgtcgcacccg
gaccacgccccgatggacgtgattgaggtggactacggcgagcaggtgctgtggccggac
cactgcgtccagggcaccgagggggccgagtttcacccggacctcgacaccgccccgtcg
gagctgatcctccgcaaggggttccggcccggaatcgactcctactccgccttctacgaa
aacgacggcacaacgccgaccggactgacgggctacctgcgggagcggggcatcgacacg
ctctacttgtgcggcctcgccacggacttctgcgtgaagtggtcggccgtcgacgggcgc
gaagaggggttcgacgtgtacgtgatcgaagacgcgacccgtggcatcgaccaggacggc
tcgctggcgcaggcctgggacgagatgaacgaggcgggcgtccaggtcatttcctcggaa
gccgcgctcgacctggccgcagcgtga

DBGET integrated database retrieval system