KEGG   Salinibacter ruber DSM 13855: SRU_1457Help
Entry
SRU_1457          CDS       T00312                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SRU_1457 (pncA)
Enzymes [BR:sru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SRU_1457 (pncA)
    3.5.1.-  
     SRU_1457 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1814673..1815299
Genome map
AA seq 208 aa AA seqDB search
MDALLIVDLQNDFCPGGALAVPEGDTIVPTVNAMAARFDHVIQTQDWHPAGHQSFASSHP
DHAPMDVIEVDYGEQVLWPDHCVQGTEGAEFHPDLDTAPSELILRKGFRPGIDSYSAFYE
NDGTTPTGLTGYLRERGIDTLYLCGLATDFCVKWSAVDGREEGFDVYVIEDATRGIDQDG
SLAQAWDEMNEAGVQVISSEAALDLAAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacgcactcctcatcgtcgaccttcaaaacgacttttgtcccggcggcgccctggcg
gtgccggagggggacaccatcgtcccgaccgtgaatgcgatggccgcccggttcgaccac
gtcatccagacccaggactggcacccggccggccaccagtcgttcgcctcgtcgcacccg
gaccacgccccgatggacgtgattgaggtggactacggcgagcaggtgctgtggccggac
cactgcgtccagggcaccgagggggccgagtttcacccggacctcgacaccgccccgtcg
gagctgatcctccgcaaggggttccggcccggaatcgactcctactccgccttctacgaa
aacgacggcacaacgccgaccggactgacgggctacctgcgggagcggggcatcgacacg
ctctacttgtgcggcctcgccacggacttctgcgtgaagtggtcggccgtcgacgggcgc
gaagaggggttcgacgtgtacgtgatcgaagacgcgacccgtggcatcgaccaggacggc
tcgctggcgcaggcctgggacgagatgaacgaggcgggcgtccaggtcatttcctcggaa
gccgcgctcgacctggccgcagcgtga

DBGET integrated database retrieval system