KEGG   Salinibacter ruber DSM 13855: SRU_1459Help
Entry
SRU_1459          CDS       T00312                                 

Gene name
yfcX
Definition
fatty oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRU_1459 (yfcX)
   01212 Fatty acid metabolism
    SRU_1459 (yfcX)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SRU_1459 (yfcX)
   00650 Butanoate metabolism
    SRU_1459 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    SRU_1459 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    SRU_1459 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SRU_1459 (yfcX)
   00310 Lysine degradation
    SRU_1459 (yfcX)
   00380 Tryptophan metabolism
    SRU_1459 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SRU_1459 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SRU_1459 (yfcX)
   00281 Geraniol degradation
    SRU_1459 (yfcX)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SRU_1459 (yfcX)
Enzymes [BR:sru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SRU_1459 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SRU_1459 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SRU_1459 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1816929..1819088)
Genome map
AA seq 719 aa AA seqDB search
MPNALSVPTDLLTLTVDETGVATLALDAPDASVNKISWDTLNAFSDALDVVETHADLSGL
VIASGKPDSFIVGADLAMLQTFEIPAEARRLSREAHALGERVRSLPVPTVAALHGPVMGG
GLELALNCDYRVASTADATKMALPEVQLGLLPGGGGTQLLPRLVGVQQALRLMLTGKNTY
PDKARRIGLVDALIHPPGLRHAARRAARELAAGTRTVERAEQSLGDRLLEGNPVSRRVIY
RQARTRTERRTRGNYPAPPRIIDAVRTGMEEGLEAGLDTERQHFGELVFTPESQALVSIF
FAKRDAETNPQPEQARPVDTVGVLGAGLMGSGIAQVSAQNGLDVVLTDQSLALAAEGKKA
IWSAVTEQEDKGIINTFTRDQIVERVAPTADYAPLQAADVVIEAVPEDLSIKHAVLSEVE
TVVDADTVLASNTSALPISTIAEGVDDPSRVLGMHYFSPVPDIPLLEIVVTEETSDEALA
TAYAAGLAQDKTVIVVNDGPGFYTTRILALYMNEALLLFEAGAEIEAVDEAMMDAGFPMG
PFELFDLVGLDVAAKITDVMGEALSPERVDISDRAGRLAEADLLGQKTNRGFYEYDADDD
ADDKDPQGVNDAVYRHRDASSRSTPPAGAIQDRLLLMMVNEAVRCLEDEVLRAPIDGDLG
AVFGLGFPPFLGGPFRHADRAGAASIVDTLQRLADRHGPRFAPADRLQTHAAQDTTFHS
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacgccctctctgtgcccacggacctcctgaccctgacggtcgacgagaccgga
gtggccacgctcgcgctggatgcccccgacgcgtcggtcaacaagatctcttgggacacc
ctgaacgcgttttccgacgccctggatgtggttgagacccacgccgacctgtccgggctg
gtgatcgccagcggcaagccggactcgttcatcgtcggggccgacctggcgatgctgcaa
acgttcgagatcccggcggaggcgcggcgcctgagccgcgaggcccacgccctcggggag
cgggtccgaagcctcccggtcccgaccgtggccgccctccacggcccggtgatggggggc
ggcctggagctggcgctcaactgcgactaccgcgtcgcctccaccgccgacgcgaccaag
atggccctacccgaggtgcagctcggccttctgcccggcgggggcggcacccagctgctg
ccgcgcctcgtgggcgtgcagcaggccctcaggctcatgctgaccggaaaaaacacgtac
ccggacaaggcgcggcgcatcggcctggtcgacgccctcatccacccgcccggcctccgc
catgcggcgcggcgggcggcccgtgagctggcggcgggcacccgcaccgtcgagcgtgcc
gagcagtcgctcggggaccgcctgctggagggcaaccccgtcagtcggcgcgtcatctac
cggcaggcccgcacacggaccgagcgccgcacccggggcaactaccccgccccgccccgc
atcatcgacgcggtgcgcacggggatggaggagggcctggaggcggggctcgacacggag
cggcagcacttcggcgagctcgtgttcacgcccgagtcgcaggccctcgtgtcgatcttc
tttgccaagcgggacgcggagacgaacccgcagcccgaacaggcgcgcccggtcgacacc
gtgggcgtgctcggggcgggcctcatgggcagtggcatcgcgcaggtgtcggcccagaac
gggctcgacgtcgtgcttacggaccagtcactggcgctcgcggccgaggggaagaaggcc
atctggtccgcggtgaccgagcaggaggacaagggcatcatcaacacgtttacgcgagac
cagattgtagagcgggtcgcccccaccgccgactatgcgcccctccaggcggccgacgtc
gtgattgaagccgtgccggaggacctgtcgatcaagcacgcggtgctgtcggaggtagag
acggtcgtcgacgcggacacggtgctggcctccaacacctccgccctccccatctcgacg
atcgccgagggcgtggacgacccgtcccgcgtgctcgggatgcactacttctcccccgtc
cccgacatcccactgctggagatcgtcgtcaccgaggagacctccgacgaggcactggcc
accgcctacgccgccggcctcgcgcaggacaagaccgtcatcgtggtgaacgacggcccg
ggcttttacaccactcgcatcctcgccctctacatgaacgaggccctgctgctcttcgag
gccggggccgagatcgaggcggtcgacgaggcgatgatggacgccgggttcccgatgggc
ccgttcgagctgttcgacctggtgggcctggacgtggcggccaaaattacggacgtgatg
ggcgaggccctctcgccggaacgcgtcgacatcagcgaccgggccggccggctcgcggag
gccgacctgctgggccaaaagaccaaccgcggcttctacgagtacgacgcggacgacgac
gccgacgacaaggacccgcagggcgtcaacgacgccgtgtaccggcaccgcgatgcctcg
tcccgatcgaccccgcccgccggcgcgatccaggaccgcctgcttctcatgatggtcaac
gaggccgtccggtgcctcgaagacgaggtgctccgcgcccccatcgacggcgacctcggg
gccgtgtttgggctcggctttccgccgttcctcggcgggcccttccgccatgccgaccgt
gcaggggccgcctccatcgtggacaccctccagcgcctggccgatcggcacggccctcgc
tttgccccggccgaccgcctccagacccacgccgctcaggacaccacctttcactcgtaa

DBGET integrated database retrieval system