KEGG   Salinibacter ruber DSM 13855: SRU_1553Help
Entry
SRU_1553          CDS       T00312                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00860  Porphyrin and chlorophyll metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
Module
sru_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SRU_1553 (hemD)
Enzymes [BR:sru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SRU_1553 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 3851890
NCBI-ProteinID: YP_445674
UniProt: Q2S2A7
Position
complement(1937521..1938309)
Genome map
AA seq 262 aa AA seqDB search
MRPRLAWPCGHLASTMSAAPDVILLRSADDEAPDRYRAALREAGLRAVCEPVLAFTFPRQ
AQLRDRLAAPDPYAGLLATSPRATVALEQVFASHEALADGWADRLAYAVGPKTAARLRAL
GLRARGDDTGTADALAARIVKDDPDAPLLFLSGNRRRETLPEALRAAEVRFDELVVYETH
ARTDLDVPARGRASWLVFFSPSGLEAVTRAEGVDVQAHRLAAIGPTTAEALEGDGHAVEA
VADEPSPDGLVAALQRAGARSS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgagaccccgtctcgcgtggccctgcgggcatctggcatcgaccatgagcgccgctccc
gacgtcatccttctccggtcggcggacgatgaagccccggaccggtaccgggccgccttg
cgcgaggcggggctgcgggcggtctgcgagcctgtactcgccttcacgttcccccgacag
gcacagctccgcgaccggctggccgcacccgacccgtacgcggggctcctcgccaccagt
ccgcgggccactgtcgccctcgaacaggtgtttgcgtcccacgaagcactcgcggacgga
tgggcggaccgcctggcgtacgcggtggggccgaaaaccgcggcccgcctgcgggcgctg
ggactccgtgcccgcggggacgatacaggcactgcggacgccctggccgcgcgcatcgtc
aaggacgatccggacgcgcccctgctcttcctgtccgggaatcgacggcgtgagacgttg
ccggaggccctgcgggccgcggaggtccgtttcgacgagctggtggtgtacgagacgcac
gcccgcactgatctcgacgtgccggcgcgggggagggcgtcctggctcgtctttttcagc
ccgtccggcttggaagcggtgacccgcgcggagggggtagacgtgcaggcccatcggctc
gcggccatcgggccgaccacggcggaggccctagagggcgacgggcacgccgtggaggcg
gtggcggacgagccgtctccggatgggctcgtggcggcccttcagcgggcaggcgcgcgt
tcctcctga

DBGET integrated database retrieval system