KEGG   Salinibacter ruber DSM 13855: SRU_1669Help
Entry
SRU_1669          CDS       T00312                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SRU_1669 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRU_1669 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SRU_1669 (trpB)
Enzymes [BR:sru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SRU_1669 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2071644..2072864
Genome map
AA seq 406 aa AA seqDB search
MSSPATTSRADTLPDTDGHFGSYGGAFVPETLTPVLEELKAAYDTYKDDPDFQADLRALL
REYAGRPTPLSYCDRLTERIGGARIYAKREDLCHTGAHKINNTLGQILLATRMGKERIIA
ETGAGQHGVATATVCAKFGVDCVIYMGAEDMERQRLNVERMELLGAEVRAATSGSQTLKE
ATNEAIRDWVSNPDDTFYIIGSVVGPHPYPMMVRNFHRVIGTETRRQLREETGRETPDAI
AACVGGGSNAIGIFHPFLDDPEVQLHGTEAAGGGLDGDHAATLAEGSPGVLHGAMSYLLQ
DDAGQVSLAHSLSAGLDYPGVGPEHAHLRDEGRVSYHPVTDDEALDGVELLSQTEGIIPA
LETAHAVALLPELARTLAEERGDDAVLVFNCSGRGDKDMQTIAAHR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcccgctaccacgtctcgtgcggacaccctccccgataccgatggccacttc
ggctcgtacgggggagcgttcgtgccggagacccttacccctgtactggaggagttgaag
gccgcctacgacacgtataaggacgacccggacttccaggccgacctccgcgccctcctc
cgtgaatacgccgggcggcccacccccctctcctactgcgaccgcctgaccgaacggatc
ggcggggcccgcatctacgcgaagcgggaagacctttgccacaccggggcccacaaaatt
aacaacacgctcggccagatcctgctggcgacgcgcatgggcaaggagcgcatcattgcc
gaaaccggggccgggcagcacggggtggccaccgccacggtctgcgccaagttcggcgtc
gactgcgtgatttacatgggggcggaggacatggaacgccagcgcctcaacgtggagcgc
atggagctgctgggcgcggaggttcgggcggcgacctcgggcagccaaaccctgaaggag
gccaccaacgaggccattcgggactgggtgtccaacccggacgacacgttctacatcatc
ggctccgtcgtgggcccgcacccctatcccatgatggtgcgcaactttcaccgggtgatc
ggcaccgagacgcgtcgccagctccgtgaggagaccggccgggagacgccggacgccatc
gcggcctgcgtggggggcggctccaacgccatcggcatcttccatccgttcctcgacgac
cccgaggtgcaactgcacgggacggaggcggcgggcggcggcctcgacggcgaccacgcg
gccacccttgccgaggggtcgccgggcgtcctgcacggggcgatgagctacctcctgcag
gacgacgccggtcaggtgagcctcgcccactcgctctccgccggcctcgactaccccggc
gtggggcccgagcacgcccacctgcgcgacgagggacgcgtctcgtaccacccggtgacc
gacgacgaggccctggacggggtggagcttctctcccaaacggaaggcatcatcccggcg
ctcgaaacggcgcacgccgtcgccctcctgcccgagctggcgcgcaccctggccgaggag
cgcggggacgacgccgtcctcgtctttaactgctccggccggggcgacaaggacatgcag
accatcgccgcacaccggtaa

DBGET integrated database retrieval system