KEGG   Salinibacter ruber DSM 13855: SRU_1670Help
Entry
SRU_1670          CDS       T00312                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SRU_1670 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRU_1670 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SRU_1670 (trpA)
Enzymes [BR:sru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SRU_1670 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2072917..2073753
Genome map
AA seq 278 aa AA seqDB search
MSRLDETFDALGPDEKAMGLFLTDGFPNPDATVPLLHAIDRGGADFIELGMPFSDPLAEG
RPIQRASARALSHGVTLPDTLRTVEAFREDSDTPLLLMGYVNPVFKYGVDAFCRDAAEAG
VDGLILPDLPPQESDALCDAAAAHGLELVFLIAPNTSDERIRVVDERATGFVYAVSVTGL
TGSDLAETPSVDEYLMHARDFVAQNPLLVGFGIKTHDDAMELSRHTDGFIVGSALINRVE
ALWEDPERSTTDRLDTVEGFARHLKSGTPVPTPQPNPA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgactcgacgagacgttcgatgccctcggccctgacgaaaaggccatggggctc
ttcctcacggacgggttcccgaatcccgacgcgaccgtccccctgctccacgcgatcgat
cgcgggggggctgacttcatcgagctgggcatgcccttcagcgatccactggccgaaggg
cgtcccatccagcgggccagcgcccgggccctctcccacggggtcacactgcccgacacc
ctccggaccgtcgaggcgtttcgggaggacagcgacacgcccctcctgttgatgggctac
gtcaacccggtgttcaagtacggggtcgatgccttctgccgggacgcggcggaggccggc
gtcgacggcctcatcctgccggacctgcccccgcaggagagcgacgcgctctgcgacgcg
gccgccgcccacggcctggagctggtcttcctgatcgcccccaacacctccgacgaacgg
attcgggtcgtcgacgagcgggccacgggcttcgtctacgccgtgagcgtaaccggcctc
acgggcagcgacctggccgagacgccgagcgtagacgagtatctgatgcacgcccgagat
tttgtggcacaaaaccccctcctcgtcggcttcggcatcaagacccacgacgacgcaatg
gagctgagccggcacaccgacggcttcattgtcggctccgccctcatcaaccgcgttgag
gccctttgggaggacccggagcggtcgacgacggaccgcctcgatacggtggaggggttt
gcccgccacctcaaatcggggacgccggtccctacccctcaacccaacccggcatga

DBGET integrated database retrieval system