KEGG   Salinibacter ruber DSM 13855: SRU_1684Help
Entry
SRU_1684          CDS       T00312                                 

Gene name
acs
Definition
acetyl-CoA synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sru01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sru00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sru00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sru00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:sru00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2087745..2089736)
Genome map
AA seq 663 aa AA seqDB search
MADADAALEARLSDQEYLRPPSAFVGQANVSDPAIYDRFDDFPEGFEEYADLLDWDTRWD
EVFDGSDPPFFEWFTGGELNACYNCVDRHLHERPNQAAFIWEGEDGTRRTLTYRDLYREV
NKMAASLRDVGVQEDDVVTLHLPMVPALPITMLACARIGAPHSVVFGGFSASALAQRATD
ADSDVIVTIDGYYRRGEFLHHKEKADTAVEEADTDIDTVLVWERHEGTLHPEADLEEGRD
ILVSELLANNERARVEPVSRDAEDTLFLMYTSGTTGKPKGAQHRTGGYLSYVAGTSKYVL
DIKPNDTYWCAADIGWITGHSYIVYGPLALGTTSVMREGAPDHPHKGVTWEIAERHDVDI
FHTSPTAVRMYMKWGKEHPASYDFNFRHMTTVGEPIQPEAWLWYYTHIGNEDAVIVDTWW
QTETGGHLITNLPALQDMKPGSAGRPCPGIQPAIYDNNGTPVEAASGQAGNLVIERPWPG
MLQTVYGDDQRFINEYWRRFSDVDSDDWRDWVYEAGDGAVHAQDGYFRVLGRLDDVMNVA
GHRLGTMELESAVAQVSEVAEAAVAARQDDQKGNVPDVYVTPRDGVAASDELRQDIVAAV
EKEIGAFARPGNVIFVGDLPKTRSGKIMRRLLENISNGKDLGDTTTLRDPSVPEEIRRQV
QEA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgccgacgctgccctcgaagcccgactgtccgaccaggagtatctccgccct
ccctccgcattcgtggggcaggccaacgtgtcggacccggcgatctacgatcggttcgac
gactttccggaaggatttgaggagtacgccgaccttctggactgggacacccgctgggac
gaggtcttcgacgggtccgacccgcccttcttcgagtggtttacgggcggggagctcaac
gcctgctacaactgcgtggaccgtcacctccacgagcggcccaaccaggcggccttcatc
tgggagggcgaggacggcacccggcgcacgctgacgtaccgggatctctaccgggaagtc
aacaagatggcggcctcgctccgcgacgtgggggtccaggaggacgacgtggttacgctc
caccttccgatggtgcccgcgctgcccatcaccatgctcgcctgtgcccgcatcggcgcg
ccgcactcggtcgtctttggcggcttctcggccagcgccctcgcccagcgcgccaccgat
gccgactccgacgtcatcgtcacgatcgacggctactaccggcggggcgagttcttgcac
cacaaggagaaggccgacaccgccgtggaggaggcggacaccgacatcgacacggtgctg
gtgtgggagcgccacgagggaacccttcaccccgaggccgacctggaggagggacgcgac
atcctcgtgtccgagctcctcgccaacaacgaacgggcgcgagtcgagccggtgtcgcgc
gacgccgaagacactctcttcctgatgtacacgtccggcaccaccggcaagccgaagggg
gcccagcaccggaccggcggctacctcagctacgtggcgggcacgtcgaagtacgtcctc
gacatcaagcccaatgacacctactggtgtgccgccgacatcggatggattaccggccac
tcctacatcgtctacggcccgctcgccctaggcacgacgagcgtgatgcgggagggcgcg
cccgaccatccgcacaagggcgtcacctgggaaattgccgagcggcacgacgtcgacatc
ttccacacctcccccacggcggtgcggatgtacatgaagtgggggaaggagcacccggcg
tcgtacgacttcaacttccgccacatgacgacggtcggggagcccattcagccggaggcg
tggctctggtactacacgcacatcggaaacgaggacgccgtcatcgtcgacacctggtgg
cagacggagacggggggccacctcatcaccaacctgccggccctacaggacatgaagccc
ggctcggccgggcgtccgtgccccggcatccagccggccatctacgacaacaacggcacg
cccgtggaggccgcgagcgggcaggccggcaacttggtgatcgagcgcccctggccgggc
atgctgcagaccgtgtacggcgacgaccagcgcttcatcaacgagtactggcgccgcttc
tcggacgtcgactccgacgactggcgcgactgggtctacgaggccggggacggggccgtg
cacgcccaggacggctacttccgcgtcctggggcgcctcgacgacgtgatgaacgtggcc
gggcaccggctcggcaccatggagctggagtcggccgtggcccaggtgtccgaggtggcc
gaggccgcagtggccgcccggcaggacgaccagaagggaaacgtgcccgacgtgtacgtc
acgccccgcgacggggtggcggcgtccgacgagctccggcaggacatcgtcgccgccgtt
gagaaagagatcggggcctttgcccgcccgggaaacgtcatcttcgtcggggatctcccc
aagacgcgctccggcaagattatgcgtcgcctcctcgaaaacatctccaacgggaaggac
ctcggcgacaccaccaccctccgcgacccgagcgtccccgaagaaatacggcggcaggtt
caggaggcgtag

DBGET integrated database retrieval system