KEGG   Salinibacter ruber DSM 13855: SRU_1820Help
Entry
SRU_1820          CDS       T00312                                 

Gene name
acs
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRU_1820 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_1820 (acs)
   00620 Pyruvate metabolism
    SRU_1820 (acs)
   00640 Propanoate metabolism
    SRU_1820 (acs)
  Energy metabolism
   00680 Methane metabolism
    SRU_1820 (acs)
Enzymes [BR:sru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SRU_1820 (acs)
Lipid biosynthesis proteins [BR:sru01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SRU_1820 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2252046..2253920
Genome map
AA seq 624 aa AA seqDB search
MDRHDLADLSALRTRAASDVAWFWEAVLDDLDIEFYDPYDQIVDLSGGIERPAWCVNGSM
NIVHNLLDKWQGTPAEDRAALRWEGEDGATRTLTYGELHQRVCRCANALRDLGLGRGDRI
GLFMPMTPEIVIAFLAIAKIGGVLLPLFSGYGVGALVTRLQGAEADALFTADGFARRGRP
IDMKETADEAVAQCPTVEHVIVHRHLGRDDTPMTTGRDRFWADFVAGHDPEARTARTGAD
DPVMVIYTSGTTGPPKGTVHTHCGFPIKGAQDMYHPMDLKPGETMYWMSDMGWMMGPWLV
FGTLTVGATMVLYDGAPDHPDAGRLWRLVDDHEVTHLGVSPTLIRALKTHGDAPVRASDR
SSLRAIGSTGSPWDPESWSWCFETVLDGEKPILNYSGGTEIAGGILCGNFLEPLKPAAFS
GPVPGMDADVVDEDGTPVREEVGELVLRAPWIGMTRGFWGDDDRYHDAYWDRLDDVWVHG
DFAAVDEDGLWYILGRSDDTINVAGKRLGPAEIEALLNAHGAVAESAAIGVPHDVKGSEI
VAFVVLEPDYDETAALREELMQGVVDEMGKPLKPREIRFADALPKTRNAKVMRRVIRAAY
LGEELGDTSSLEDPGTVDAIQEAR
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggaccggcacgacctggcggacctctcggccctccgcacacgggccgcctcggacgtg
gcctggttctgggaggcggtgctcgacgacctggacatcgagttttacgacccgtacgac
cagatcgtcgatctctcggggggcatcgagcgacccgcctggtgcgtgaacgggagcatg
aacatcgtccacaacctgctcgacaagtggcagggcacgcccgcggaggaccgcgcggca
ctgcgttgggagggggaagacggggccacgcgaaccctgacgtacggcgagctccaccag
cgcgtctgtcgctgtgcaaacgcgctgcgggacctggggctcggaaggggcgaccggatt
gggctctttatgcccatgactccggagatcgtcatcgcgttcctggcgatcgcaaaaatc
ggaggggtgttgctgcccctcttcagtgggtacggggtcggcgcactggtcacccggctc
cagggggccgaggcggacgccctcttcacggccgacggctttgcgcgccgggggcgcccc
atcgacatgaaagagaccgcggacgaggcggtcgcccagtgcccgacggtcgaacacgtc
attgttcaccggcatctcgggcgcgatgacacgcccatgacgaccggccgcgaccgcttc
tgggcggatttcgtggcggggcacgacccggaggcccgcacggcccgcaccggggccgac
gacccggtcatggtcatctacaccagtggcaccaccgggccgccgaaagggaccgtacac
acccactgcggcttccccatcaagggcgcgcaggacatgtaccatccgatggacctgaag
ccgggggagacgatgtactggatgagcgacatgggctggatgatggggccatggctcgtc
ttcggcacgctcacggtgggggcgaccatggtgctctacgacggggcccccgaccatccg
gacgccggacgcctctggcgactagtggacgaccacgaggtgacgcacctcggcgtgtcc
cccaccctcatccgcgccctcaagacgcacggcgacgcgcccgtaagggcgtccgaccgg
tcgagccttcgcgcgatcgggtcgaccggcagtccctgggaccccgagtcctggtcgtgg
tgcttcgaaacggtcctcgacggcgagaagccgattctcaactactccggcggcaccgag
atcgccggcggcatcctctgtggcaacttcctggagcccctcaagcccgccgcgttctcc
ggcccggtccccggcatggacgccgacgtggtggacgaggacggcacgccagttcgggaa
gaggtcggcgagctcgtcctgcgggcgccctggatcggcatgacgcgaggcttctggggc
gacgacgaccgctaccacgacgcctactgggaccgactcgacgacgtgtgggtgcatggc
gacttcgcggccgtcgacgaggacgggctctggtacatcctgggccgctcggacgacacg
atcaacgtggccggcaagcgcctgggcccggcggagattgaggcgctcctcaacgcccac
ggggcggtcgccgagagcgcggccatcggcgtgccccacgacgtgaagggctccgagatc
gtcgcgttcgtggtgctggagccggactacgacgaaaccgcggccctccgcgaggagctg
atgcagggggtcgtggacgagatgggcaagcccctgaaaccgcgcgagattcgtttcgcc
gacgccctgcccaagacgcgcaacgccaaggtcatgcggcgcgtcatccgggcggcgtac
ctcggcgaagagctcggcgatacgtcgagcctggaagacccgggcaccgtcgacgccatc
caggaggcgcggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system