KEGG   Salinibacter ruber DSM 13855: SRU_1849Help
Entry
SRU_1849          CDS       T00312                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SRU_1849 (dxr)
Enzymes [BR:sru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SRU_1849 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
Position
complement(2284386..2285591)
Genome map
AA seq 401 aa AA seqDB search
MDAVSQNGTSASEPRRLALLGATGSIGTQTLEVVRLFPDRFDVRVLTCRQNVERLAAQVQ
EFRPECVAVGSAESAEAFKKTLPADAPDVRVLVGTEGLCEAATRSDVDVVLGAVVGFAGL
RPILRAVRAGKQVALANKETLVVGGALVTQAVADGGGQLLPVDSEHSAIFQCLAGESERA
VEELVLTASGGPFWDRPADTFGDITVEEALDHPNWSMGAKITVDSATMMNKGLEVIEAKW
LFDVPVDRIQVLVHPQSIVHSMVSFADGAVKAQLGVPDMKVPIQYALSYPSRWPASHERL
DWDELSRLDFERPDLEKFPCLRLAYDALEAGGTAPALLNAANEAAVGRFLEGQLGFLDIP
RAVERVLEQLPVQASPTLDDLVAADTEARRRVEELPLPTSN
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagtctcccagaacggaacgtcggcctcggagccgcgacggctcgccctgctc
ggggcgaccggatcgattggcacccagacacttgaggtcgtccggctctttccggaccgg
ttcgacgtgcgggtgctcacctgtcgccagaatgtggagcgccttgccgcgcaggttcaa
gagttccgtcccgagtgcgtggccgtcgggtccgccgagagcgccgaggcgttcaagaaa
acgctgccggcggacgcgccggacgtgcgggtcctcgtggggacggaggggctctgcgag
gcggccacgcggtcggacgtggacgtggtgctgggggcggtggtcggctttgcggggctc
cggcccatcctgagggcggtgcgggcggggaagcaggtcgccctcgccaacaaagaaacg
ttggtcgtggggggcgcgctggtcacgcaggccgtggcggacggaggcgggcagctactg
cccgtcgacagcgagcactcggcaatttttcagtgcctggcgggcgagtccgagcgggcg
gtcgaggagctcgtgctgaccgcgtccggcgggccgttctgggaccgcccggccgacacc
ttcggcgacattacggtggaggaggccctcgaccatccgaactggtcgatgggggcgaaa
atcacggtcgactccgccaccatgatgaacaaggggctggaggtgattgaggcgaagtgg
ctgttcgacgtgccggtcgaccgcattcaggtgctcgtccacccgcagtccatcgtgcac
tcgatggtgtcgtttgccgacggggccgtgaaggcgcagctcggcgtcccggacatgaag
gtgcccattcagtacgcgctgagctacccgtcccgctggcccgcgtcccacgagcgactg
gactgggacgaactctcgcgcctcgacttcgagcggccggacctggagaaatttccgtgc
ctgcggctcgcctacgacgccctggaggcggggggcacggccccggccctcctgaacgcc
gccaacgaggcggccgtggggcgctttctggagggccaactgggcttcctggacattccc
cgtgccgttgaacgggtgcttgagcagctccccgtgcaggccagtcccaccctggacgat
ctggtggcggcggacacggaggcccgccggcgggtcgaggaactccccttaccgacatca
aattga

DBGET integrated database retrieval system