KEGG   Salinibacter ruber DSM 13855: SRU_1859Help
Entry
SRU_1859          CDS       T00312                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SRU_1859 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SRU_1859 (murA)
Enzymes [BR:sru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SRU_1859 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2295679..2297106
Genome map
AA seq 475 aa AA seqDB search
MSPLPTNNFTHRRFHPAPFLISHSVQPPSSHQHCCPMDKLVVRGESSLQGPLTVSGSKNT
ALPLMAATLLAKGPSTITNVPDLRDVRTFSKVIRHGGPAVAFDADAHTLSVDATTIETPV
APYELVKKMRASFYMLGALLGRCGTAKVSLPGGCAWGPRPVDLHIEGMKQFGADIELDEG
YVHASTPNGGLAGGTFRLEPVSVGATINLLLAAVTAQGGSKIENAAKEPDVVAFGRALQE
MGAQIDGLGTRTIEVQGVDALNAGTFRNTPDRIELGTFILMAATAAEPGRPVDIHEGTHE
HLGPVFKEKLAETGVDVSYGTEAVTVTRPETLRPVSVETSPFPGFATDLQAQWTVLLSRT
DGTATVTDTIYDDRFKHVPELQRLGMEIEVDGNTATIHGGAPLKGAKVMSTDLRAGVSLV
MAGMLAEGRTDVLRVYHLDRGYEDLEDKLRGAGVSIHREAYDEFAEPDQAPAQDG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcccctgccgacgaacaatttcacgcatcggcgttttcatccggcaccatttttg
atttcacactcggtccagcccccttcctcccaccagcattgctgccccatggataaactc
gtcgtccgcggagagtcgtcgctccaaggcccccttaccgtgagcggatcgaaaaacacg
gcccttccgctcatggccgccacccttctggcgaaaggcccctcgaccatcaccaacgta
ccggacctgcgggacgtgcgcaccttttcgaaggtcattcggcacggggggccggcggtc
gccttcgatgccgacgcccacaccctctcggtggacgcgaccaccattgagacgccggtg
gcgccctacgaactggtcaagaagatgcgggcctccttctacatgctcggcgcgctcctg
gggcgctgcgggacggccaaggtgtccctccccggaggctgcgcgtgggggccccgaccg
gtcgatctgcacattgagggcatgaagcagttcggggccgacattgagttggacgagggc
tacgtgcacgcctccaccccgaatggcgggctcgcgggcggcaccttccggctggagccc
gtgagcgtgggggccaccatcaaccttctgctcgccgccgtgacggcccagggcggctcc
aagatcgagaacgcggccaaggagccggacgtggtggccttcgggcgcgccctgcaggag
atgggggctcagatcgacggcctcggcacccggacgatcgaggtgcagggcgtcgacgcg
ctcaacgcgggcaccttccgcaacacgcccgaccgcatcgagctgggcaccttcatcctc
atggccgcgaccgccgccgagcccggccgccccgtcgacatccacgagggcacccacgag
cacctgggcccggtcttcaaggaaaagctggccgaaacgggggtcgacgtgtcctacggc
accgaagccgtcaccgtcacgcgccccgagacgctccgtccggtttccgtcgagacgtcc
cccttccccggcttcgcgaccgacctgcaggcacagtggaccgtcttgctcagccgcacc
gacggcacggccacagtgacggacacgatctacgacgaccggttcaagcacgtcccggag
ctgcagcgcctcggcatggagatcgaggtggacggaaacacggcgacaatccatgggggc
gcgccgctgaagggggccaaggtcatgagcacggacctgcgggccggcgtttccctcgtg
atggccggcatgctcgccgagggccgcacggacgttctccgcgtctaccacctcgaccgc
gggtacgaagacctcgaagacaagctccgcggcgccggagtctccatccaccgcgaggcg
tacgacgagtttgctgagccggaccaggcccccgctcaggacgggtaa

DBGET integrated database retrieval system