KEGG   Salinibacter ruber DSM 13855: SRU_1905Help
Entry
SRU_1905          CDS       T00312                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00010  Glycolysis / Gluconeogenesis
sru00051  Fructose and mannose metabolism
sru00562  Inositol phosphate metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01130  Biosynthesis of antibiotics
sru01200  Carbon metabolism
sru01230  Biosynthesis of amino acids
Module
sru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sru_M00002  Glycolysis, core module involving three-carbon compounds
sru_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_1905 (tpiA)
   00051 Fructose and mannose metabolism
    SRU_1905 (tpiA)
   00562 Inositol phosphate metabolism
    SRU_1905 (tpiA)
Enzymes [BR:sru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SRU_1905 (tpiA)
Exosome [BR:sru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SRU_1905 (tpiA)
  Exosomal proteins of bladder cancer cells
   SRU_1905 (tpiA)
  Exosomal proteins of melanoma cells
   SRU_1905 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 3851620
NCBI-ProteinID: YP_446015
UniProt: Q2S1B6
Position
2349782..2350564
Genome map
AA seq 260 aa AA seqDB search
MLVAGNWKMNTDVPEGRALADAIAEGLSSTAADRGDVDFLVCPPYVHLPAVREALADVPV
AVGAQDMHAQDEGAYTGDVSAPMLSSIGCDAVILGHSERRTYYDETDAEVNAKAQQARAH
DLVPIVCVGETLEQRKAGEADTVVRSQVDGALSDVSIDGADELIVAYEPIWAIGTGESAA
AEQAQAMHAVIRDDLRERYGGDVADEVPLLYGGSMKPHNAYGLLSQPDIDGGLIGSASLE
AESFLGIAEKAAEVLETSGH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcgctggcaactggaaaatgaacactgacgtcccggaaggccgggcgctcgcc
gacgccatcgcggagggcctgtcgtccacggccgccgaccggggcgacgtcgacttcctc
gtctgccccccgtacgtccacctgccggccgtccgcgaggcgctggcggacgtccccgtc
gcggtgggggcccaggacatgcacgcacaggacgaaggggcctacacgggcgacgtgtcc
gcccccatgctgtcctccatcgggtgcgacgccgttattctcggccactccgagcggcgc
acgtactacgacgagaccgacgccgaggtcaacgcaaaggcccagcaggcccgtgcccac
gaccttgtgcccatcgtgtgcgtcggcgagaccctcgagcagcggaaggcgggggaggcc
gacacggtcgtccggagccaggtggacggggcgctgtcggatgtctcgatcgatggcgcg
gacgagctgatcgtggcctacgagccgatctgggccatcggcacgggggaatccgccgcc
gccgagcaggcgcaggcgatgcacgcggtgatccgggacgacctgagggagcgctacggg
ggcgacgtggcggacgaggtgccgctcctctacggcggcagcatgaagccgcacaacgcc
tacggccttctctcccagccggacatcgacgggggcctcatcggcagcgcgagcctcgag
gcggagagcttcctcggtatcgccgagaaggcggcagaggtgctcgagacgtccgggcac
tga

DBGET integrated database retrieval system