KEGG   Salinibacter ruber DSM 13855: SRU_1905Help
Entry
SRU_1905          CDS       T00312                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRU_1905 (tpiA)
   01230 Biosynthesis of amino acids
    SRU_1905 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_1905 (tpiA)
   00051 Fructose and mannose metabolism
    SRU_1905 (tpiA)
   00562 Inositol phosphate metabolism
    SRU_1905 (tpiA)
Enzymes [BR:sru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SRU_1905 (tpiA)
Exosome [BR:sru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SRU_1905 (tpiA)
  Exosomal proteins of bladder cancer cells
   SRU_1905 (tpiA)
  Exosomal proteins of melanoma cells
   SRU_1905 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2349782..2350564
Genome map
AA seq 260 aa AA seqDB search
MLVAGNWKMNTDVPEGRALADAIAEGLSSTAADRGDVDFLVCPPYVHLPAVREALADVPV
AVGAQDMHAQDEGAYTGDVSAPMLSSIGCDAVILGHSERRTYYDETDAEVNAKAQQARAH
DLVPIVCVGETLEQRKAGEADTVVRSQVDGALSDVSIDGADELIVAYEPIWAIGTGESAA
AEQAQAMHAVIRDDLRERYGGDVADEVPLLYGGSMKPHNAYGLLSQPDIDGGLIGSASLE
AESFLGIAEKAAEVLETSGH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcgctggcaactggaaaatgaacactgacgtcccggaaggccgggcgctcgcc
gacgccatcgcggagggcctgtcgtccacggccgccgaccggggcgacgtcgacttcctc
gtctgccccccgtacgtccacctgccggccgtccgcgaggcgctggcggacgtccccgtc
gcggtgggggcccaggacatgcacgcacaggacgaaggggcctacacgggcgacgtgtcc
gcccccatgctgtcctccatcgggtgcgacgccgttattctcggccactccgagcggcgc
acgtactacgacgagaccgacgccgaggtcaacgcaaaggcccagcaggcccgtgcccac
gaccttgtgcccatcgtgtgcgtcggcgagaccctcgagcagcggaaggcgggggaggcc
gacacggtcgtccggagccaggtggacggggcgctgtcggatgtctcgatcgatggcgcg
gacgagctgatcgtggcctacgagccgatctgggccatcggcacgggggaatccgccgcc
gccgagcaggcgcaggcgatgcacgcggtgatccgggacgacctgagggagcgctacggg
ggcgacgtggcggacgaggtgccgctcctctacggcggcagcatgaagccgcacaacgcc
tacggccttctctcccagccggacatcgacgggggcctcatcggcagcgcgagcctcgag
gcggagagcttcctcggtatcgccgagaaggcggcagaggtgctcgagacgtccgggcac
tga

DBGET integrated database retrieval system