KEGG   Salinibacter ruber DSM 13855: SRU_1945Help
Entry
SRU_1945          CDS       T00312                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sru  Salinibacter ruber DSM 13855
Brite
Enzymes [BR:sru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SRU_1945 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2407353..2408045)
Genome map
AA seq 230 aa AA seqDB search
MTATPSDDRKYRHQRERLVETLRERGIHDERVLSAVGAVARHAFVDPALRDRAYADEALP
IGLNQTISQPFTVAYQTALLGVQPDDRILEVGTGSGFQAAVLCEMGARVYSIERHDDLLR
RARSVLDGLGYDVRTRHGDGTRGWPAFAPYDGIVVTAGAPEIPAPLLHQLREPSGEDDGP
GGRLVIPIGGREGQTMTRVRRTGSGPHDYEQEEFHSFRFVPLVDEDEGGG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaccccctcggacgaccggaaataccgccaccaacgcgaacgacttgttgag
acccttcgcgagcggggcatccacgacgagcgggtcctgtcggcggtcggggcggtggcc
cggcatgccttcgtggacccggccctccgcgatcgggcctacgccgacgaggccctcccg
attgggctcaaccagaccatctcccagcccttcacggtggcgtaccagaccgcgttgctg
ggcgtgcagccggacgatcgcatcctggaggtgggcacgggcagtgggtttcaggccgcc
gtgctgtgcgagatgggggcgcgagtctattcgatcgagcgccacgacgacctgctccgg
cgggcccgatccgtgctcgacgggctcggctacgacgtgcgaacgcggcacggggatgga
acgcgggggtggcccgcctttgcgccctacgacgggatcgtggtgaccgcgggggcgccc
gagatacccgctccgcttctccaccagctccgtgagccgtccggggaggacgacggccca
ggggggcggctcgtcattccgattggggggcgtgaggggcagaccatgacgcgcgtccgc
cgtaccggttcgggcccccacgactacgagcaggaggaatttcactcgttccgcttcgtg
cccctggtcgacgaggacgaggggggcggatga

DBGET integrated database retrieval system