KEGG   Salinibacter ruber DSM 13855: SRU_1947Help
Entry
SRU_1947          CDS       T00312                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00790  Folate biosynthesis
sru01100  Metabolic pathways
Module
sru_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRU_1947 (folP)
Enzymes [BR:sru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SRU_1947 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase AP_endonuc_2 AAA_25
Motif
Other DBs
NCBI-GeneID: 3851507
NCBI-ProteinID: YP_446057
UniProt: Q2S174
Position
complement(2408972..2409835)
Genome map
AA seq 287 aa AA seqDB search
MLGGDDYTLDCRPGSPEAAGAHVMGVLNVTPDSFSDGGQYVTVEKALSRAAEMLSEGASI
IDVGGESTRPGADPVSKEDERDRVVPVIDALTDRFPEAVVSVDTYKPDVARASLAAGADI
VNDVTGLRHDPEMAAAAADWKAPLMVMHSMGEPGDLTRPREYDDVTAQVRDALARTVETA
EQAGVEQVIIDPGFGFGKSDAENFRLLNEIDELLTLNCPVLVGVSRKSTIGATLGTPDDP
APVDERLFGSLGATAAAVARGATIVRTHDIAPTVEMLKVLGVTLRQR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcggggacgactacacgctcgactgccggcccgggagcccggaggctgcgggg
gctcacgtgatgggggtcctgaacgtgacccccgactccttttccgacggcggccagtac
gtgaccgtcgagaaggcactgtcgcgggccgccgagatgttgagtgagggggcctccatc
atcgacgtagggggcgagtcgacccggcccggggcggatcccgtctcgaaagaagacgag
cgcgaccgggtggtgcccgtcatcgacgccctcacggatcggttccccgaagcggtggtg
tcggtcgacacctacaagcccgacgtggcccgggcgtccctcgccgcgggggcggacatc
gtgaacgacgtcaccggcctgcggcacgatcccgagatggccgcggccgcggccgactgg
aaggcgcccctcatggtcatgcactcgatgggcgagcccggcgacctcacgcggccccgc
gagtacgacgacgtgacggcccaggtgcgcgacgcactggcccggacggtggagaccgcc
gagcaggccggcgtggagcaggtgatcatcgacccgggcttcggcttcgggaaatccgac
gccgaaaacttccgcctgctcaacgagatcgacgagcttctcaccctcaactgccccgtg
ctcgtgggcgtctcccgcaagagcacgatcggggccacgctgggcacgcccgacgacccc
gcgcctgtggacgagcggctcttcgggtcgctcggggcgacggcggcggccgtagcgcgg
ggggccaccatcgtgcgcacccacgacattgcccccaccgtcgagatgctcaaggtgctc
ggggtcaccctccgtcaacggtag

DBGET integrated database retrieval system