KEGG   Salinibacter ruber DSM 13855: SRU_1947Help
Entry
SRU_1947          CDS       T00312                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRU_1947 (folP)
Enzymes [BR:sru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SRU_1947 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2408972..2409835)
Genome map
AA seq 287 aa AA seqDB search
MLGGDDYTLDCRPGSPEAAGAHVMGVLNVTPDSFSDGGQYVTVEKALSRAAEMLSEGASI
IDVGGESTRPGADPVSKEDERDRVVPVIDALTDRFPEAVVSVDTYKPDVARASLAAGADI
VNDVTGLRHDPEMAAAAADWKAPLMVMHSMGEPGDLTRPREYDDVTAQVRDALARTVETA
EQAGVEQVIIDPGFGFGKSDAENFRLLNEIDELLTLNCPVLVGVSRKSTIGATLGTPDDP
APVDERLFGSLGATAAAVARGATIVRTHDIAPTVEMLKVLGVTLRQR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcggggacgactacacgctcgactgccggcccgggagcccggaggctgcgggg
gctcacgtgatgggggtcctgaacgtgacccccgactccttttccgacggcggccagtac
gtgaccgtcgagaaggcactgtcgcgggccgccgagatgttgagtgagggggcctccatc
atcgacgtagggggcgagtcgacccggcccggggcggatcccgtctcgaaagaagacgag
cgcgaccgggtggtgcccgtcatcgacgccctcacggatcggttccccgaagcggtggtg
tcggtcgacacctacaagcccgacgtggcccgggcgtccctcgccgcgggggcggacatc
gtgaacgacgtcaccggcctgcggcacgatcccgagatggccgcggccgcggccgactgg
aaggcgcccctcatggtcatgcactcgatgggcgagcccggcgacctcacgcggccccgc
gagtacgacgacgtgacggcccaggtgcgcgacgcactggcccggacggtggagaccgcc
gagcaggccggcgtggagcaggtgatcatcgacccgggcttcggcttcgggaaatccgac
gccgaaaacttccgcctgctcaacgagatcgacgagcttctcaccctcaactgccccgtg
ctcgtgggcgtctcccgcaagagcacgatcggggccacgctgggcacgcccgacgacccc
gcgcctgtggacgagcggctcttcgggtcgctcggggcgacggcggcggccgtagcgcgg
ggggccaccatcgtgcgcacccacgacattgcccccaccgtcgagatgctcaaggtgctc
ggggtcaccctccgtcaacggtag

DBGET integrated database retrieval system