KEGG   Salinibacter ruber DSM 13855: SRU_2111Help
Entry
SRU_2111          CDS       T00312                                 

Definition
(RefSeq) phosphofructokinase subfamily protein
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00010  Glycolysis / Gluconeogenesis
sru00030  Pentose phosphate pathway
sru00051  Fructose and mannose metabolism
sru00052  Galactose metabolism
sru00680  Methane metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_2111
   00030 Pentose phosphate pathway
    SRU_2111
   00051 Fructose and mannose metabolism
    SRU_2111
   00052 Galactose metabolism
    SRU_2111
  Energy metabolism
   00680 Methane metabolism
    SRU_2111
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SRU_2111
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SRU_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Rhabdo_M1
Motif
Other DBs
NCBI-GeneID: 3852816
NCBI-ProteinID: YP_446217
UniProt: Q2S0R4
Position
2610801..2611940
Genome map
AA seq 379 aa AA seqDB search
MPSDSLRVGVLTGGGDCPGINAALRAVTKSLTLQHDAEVLGFLDGFRGVVDRNVEPLHYR
DVSGILTRGGTILGASNKADPFNYLPRGGADVSAQVMRTYRTLDLDALVAIGGDGTMSIA
HRLTDLGVDIVGVPKTIDNDLVGTDRTVGFDTAVSTATDAIDRIHTTAQSHHRVMIVETM
GRYSGWIALHAGVASGTDVILLPEIEYEVETVADVCRDRERSGQRFTIVAVAEGARRKEG
DYVVQERGDEYTDSIRLGGISRVLADQLREHLDTSIRTTVLGHMQRGGSPTAYDRTLATT
LGTRAATLVAEGTTGVMVAVQNDAFTQVPLDEIAGKTRTVPLDDPLIASGLDVGTSFGVA
VSDLSEAASHSKPASPIQP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgactctctccgcgtcggcgtcctgaccggcgggggcgactgccccggcatc
aatgctgcgctccgtgccgtaaccaagagcctcaccctccagcacgatgcggaggtgctc
ggcttcctggacggatttcgcggcgtcgtggaccgcaacgtcgagccgctccactaccgc
gatgtgagcggcatcctcacccggggcggcaccatcctcggggcgagcaacaaggccgac
cccttcaactaccttccccggggcggcgccgacgtgtcggcccaggtgatgaggacctac
cgcaccctcgacctggacgccctcgtggcgattggcggcgacggcaccatgtccatcgcc
caccgcctcaccgacctcggcgtcgacatcgtgggcgtgcccaagacgatcgacaacgac
ctggtgggcaccgaccggacggtcggcttcgacacggccgtcagcaccgcgaccgacgca
atcgaccgcatccatacgacggcacagagccaccaccgggtgatgatcgtcgagacgatg
ggccggtactcgggctggattgcgctccacgcgggggtcgccagtggcaccgacgtgatt
cttctgcccgaaattgagtatgaggtggagacggttgccgacgtatgccgcgaccgggag
cggagtgggcagcgcttcacgatcgtggcggtggcggagggggcccggcgcaaggagggc
gactacgtggtccaggagcggggcgacgagtacaccgactccatccgcctcggcggcatc
agccgcgtcctcgccgaccaactgcgggagcacctcgacaccagcatccggaccaccgtc
ctcggccacatgcagcggggcggatcccccacggcatacgaccgcactctcgccacgacc
ctcggcacccgcgcagccaccctggtcgcggagggaacaacgggcgtcatggttgccgtc
cagaacgacgcattcacgcaggtcccgctcgacgagatcgccggcaagacccgcaccgtg
cccctggacgacccgctcattgcttcggggctggatgtgggcacgtcgttcggggtcgcc
gtatcggacctatcggaggcagcctcccacagcaagcctgcctctcccatccagccctag

DBGET integrated database retrieval system