KEGG   Salinibacter ruber DSM 13855: SRU_2111Help
Entry
SRU_2111          CDS       T00312                                 

Definition
(RefSeq) phosphofructokinase subfamily protein
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_2111
   00030 Pentose phosphate pathway
    SRU_2111
   00051 Fructose and mannose metabolism
    SRU_2111
   00052 Galactose metabolism
    SRU_2111
  Energy metabolism
   00680 Methane metabolism
    SRU_2111
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SRU_2111
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SRU_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2610801..2611940
Genome map
AA seq 379 aa AA seqDB search
MPSDSLRVGVLTGGGDCPGINAALRAVTKSLTLQHDAEVLGFLDGFRGVVDRNVEPLHYR
DVSGILTRGGTILGASNKADPFNYLPRGGADVSAQVMRTYRTLDLDALVAIGGDGTMSIA
HRLTDLGVDIVGVPKTIDNDLVGTDRTVGFDTAVSTATDAIDRIHTTAQSHHRVMIVETM
GRYSGWIALHAGVASGTDVILLPEIEYEVETVADVCRDRERSGQRFTIVAVAEGARRKEG
DYVVQERGDEYTDSIRLGGISRVLADQLREHLDTSIRTTVLGHMQRGGSPTAYDRTLATT
LGTRAATLVAEGTTGVMVAVQNDAFTQVPLDEIAGKTRTVPLDDPLIASGLDVGTSFGVA
VSDLSEAASHSKPASPIQP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgactctctccgcgtcggcgtcctgaccggcgggggcgactgccccggcatc
aatgctgcgctccgtgccgtaaccaagagcctcaccctccagcacgatgcggaggtgctc
ggcttcctggacggatttcgcggcgtcgtggaccgcaacgtcgagccgctccactaccgc
gatgtgagcggcatcctcacccggggcggcaccatcctcggggcgagcaacaaggccgac
cccttcaactaccttccccggggcggcgccgacgtgtcggcccaggtgatgaggacctac
cgcaccctcgacctggacgccctcgtggcgattggcggcgacggcaccatgtccatcgcc
caccgcctcaccgacctcggcgtcgacatcgtgggcgtgcccaagacgatcgacaacgac
ctggtgggcaccgaccggacggtcggcttcgacacggccgtcagcaccgcgaccgacgca
atcgaccgcatccatacgacggcacagagccaccaccgggtgatgatcgtcgagacgatg
ggccggtactcgggctggattgcgctccacgcgggggtcgccagtggcaccgacgtgatt
cttctgcccgaaattgagtatgaggtggagacggttgccgacgtatgccgcgaccgggag
cggagtgggcagcgcttcacgatcgtggcggtggcggagggggcccggcgcaaggagggc
gactacgtggtccaggagcggggcgacgagtacaccgactccatccgcctcggcggcatc
agccgcgtcctcgccgaccaactgcgggagcacctcgacaccagcatccggaccaccgtc
ctcggccacatgcagcggggcggatcccccacggcatacgaccgcactctcgccacgacc
ctcggcacccgcgcagccaccctggtcgcggagggaacaacgggcgtcatggttgccgtc
cagaacgacgcattcacgcaggtcccgctcgacgagatcgccggcaagacccgcaccgtg
cccctggacgacccgctcattgcttcggggctggatgtgggcacgtcgttcggggtcgcc
gtatcggacctatcggaggcagcctcccacagcaagcctgcctctcccatccagccctag

DBGET integrated database retrieval system