KEGG   Salinibacter ruber DSM 13855: SRU_2111Help
Entry
SRU_2111          CDS       T00312                                 

Definition
phosphofructokinase subfamily protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRU_2111
   01230 Biosynthesis of amino acids
    SRU_2111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_2111
   00030 Pentose phosphate pathway
    SRU_2111
   00051 Fructose and mannose metabolism
    SRU_2111
   00052 Galactose metabolism
    SRU_2111
  Energy metabolism
   00680 Methane metabolism
    SRU_2111
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SRU_2111
Protein phosphatases and associated proteins [BR:sru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SRU_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2610801..2611940
Genome map
AA seq 379 aa AA seqDB search
MPSDSLRVGVLTGGGDCPGINAALRAVTKSLTLQHDAEVLGFLDGFRGVVDRNVEPLHYR
DVSGILTRGGTILGASNKADPFNYLPRGGADVSAQVMRTYRTLDLDALVAIGGDGTMSIA
HRLTDLGVDIVGVPKTIDNDLVGTDRTVGFDTAVSTATDAIDRIHTTAQSHHRVMIVETM
GRYSGWIALHAGVASGTDVILLPEIEYEVETVADVCRDRERSGQRFTIVAVAEGARRKEG
DYVVQERGDEYTDSIRLGGISRVLADQLREHLDTSIRTTVLGHMQRGGSPTAYDRTLATT
LGTRAATLVAEGTTGVMVAVQNDAFTQVPLDEIAGKTRTVPLDDPLIASGLDVGTSFGVA
VSDLSEAASHSKPASPIQP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgactctctccgcgtcggcgtcctgaccggcgggggcgactgccccggcatc
aatgctgcgctccgtgccgtaaccaagagcctcaccctccagcacgatgcggaggtgctc
ggcttcctggacggatttcgcggcgtcgtggaccgcaacgtcgagccgctccactaccgc
gatgtgagcggcatcctcacccggggcggcaccatcctcggggcgagcaacaaggccgac
cccttcaactaccttccccggggcggcgccgacgtgtcggcccaggtgatgaggacctac
cgcaccctcgacctggacgccctcgtggcgattggcggcgacggcaccatgtccatcgcc
caccgcctcaccgacctcggcgtcgacatcgtgggcgtgcccaagacgatcgacaacgac
ctggtgggcaccgaccggacggtcggcttcgacacggccgtcagcaccgcgaccgacgca
atcgaccgcatccatacgacggcacagagccaccaccgggtgatgatcgtcgagacgatg
ggccggtactcgggctggattgcgctccacgcgggggtcgccagtggcaccgacgtgatt
cttctgcccgaaattgagtatgaggtggagacggttgccgacgtatgccgcgaccgggag
cggagtgggcagcgcttcacgatcgtggcggtggcggagggggcccggcgcaaggagggc
gactacgtggtccaggagcggggcgacgagtacaccgactccatccgcctcggcggcatc
agccgcgtcctcgccgaccaactgcgggagcacctcgacaccagcatccggaccaccgtc
ctcggccacatgcagcggggcggatcccccacggcatacgaccgcactctcgccacgacc
ctcggcacccgcgcagccaccctggtcgcggagggaacaacgggcgtcatggttgccgtc
cagaacgacgcattcacgcaggtcccgctcgacgagatcgccggcaagacccgcaccgtg
cccctggacgacccgctcattgcttcggggctggatgtgggcacgtcgttcggggtcgcc
gtatcggacctatcggaggcagcctcccacagcaagcctgcctctcccatccagccctag

DBGET integrated database retrieval system