KEGG   Salinibacter ruber DSM 13855: SRU_2127Help
Entry
SRU_2127          CDS       T00312                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sru01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sru00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2631543..2633009
Genome map
AA seq 488 aa AA seqDB search
MPIAPRCRWDVALTRCSGPPRAFQPFNVHPKTFPRLENRSICPVELISRISTSMIPLITP
DDTARLDAIVSRGGTFSDEVDATVEDILARIRAEGDEALIELTETYDGVRPYPVQVPASV
LDGAVDALDDDLQDVLEEAAANIRHFHDKQVDESWFTDDGDGVILGQRVVPMERAGLYVP
GGTAFYPSSLLMNAIPAQVAGVDEIHLVSPPQDDGRPHPLVLATAALLGLEHIYAVGGAQ
AVGALAYGTASVPAVDTIVGPGNAYVAAAKKKVFGRVGIDSVAGPSEIGVLADATADPEF
VAADLLSQAEHDERASAVLVTPHRPLAEAVQEHVEAMVPALPRADVIEQSLADYGACVVP
DTMDAAIDLMNDLAVEHLELHVDDPWQTMTHIRHAGAIFLGAYSSEPVGDYFAGPNHVLP
TGGTARHASALGVDDFVRTQSVLSYTKDRLDETGPKIATIAEAEDLQAHAEAIRTRLDRD
GGSGSKKP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgccccgcggtgccgttgggacgttgccctcacccgatgttcggggccaccg
cgggcgttccaacctttcaacgtccaccccaaaacattcccccggctcgaaaatagatct
atttgtcctgtcgaactcatttcgcgcatttccacttctatgattcccctgatcacgccc
gacgacaccgcccgcctcgacgccattgtgagccggggcggcaccttcagcgacgaggtg
gacgccaccgtcgaggacattctggcgcggattcgtgcggagggcgacgaggccctcatc
gagctgaccgagacgtacgacggggtgcgcccctacccggtccaggtgccggcctcggtg
ctcgacggcgcggtcgacgcgctcgacgacgatctgcaggacgtccttgaggaggccgcg
gccaacatccgccactttcacgacaagcaggtggacgagtcctggttcaccgacgatggg
gacggggtgatcttgggacagcgcgtggtgccgatggagcgggccgggctgtacgtgccg
ggcggcacggccttctacccgtcgagtctgctgatgaacgcaattcccgcacaggtcgcg
ggcgtcgacgagattcacctcgtctcccccccgcaggacgacgggcgtccgcacccgctc
gtcctcgccaccgccgccctcctgggcctggagcacatctacgccgtcgggggcgcgcag
gccgtcggggcgctcgcctacggcaccgcgtcggtgccggcggtcgacacgatcgtgggc
ccgggcaacgcgtacgtggccgccgcgaagaagaaggtgtttgggcgcgtggggatcgac
tcggtggccggccccagcgagatcggcgtgctggccgacgccacggccgaccccgagttc
gtggccgccgacctgctctcacaggccgagcacgacgagcgggcctccgcggtcctcgtc
acgccccaccggcccctggccgaggccgtgcaggagcacgtggaggcgatggttccggcc
ctcccccgtgccgacgtgatcgagcagtccctcgccgactacggggcgtgcgtcgtgccc
gacacgatggacgcggccatcgacctcatgaacgacctcgccgtggagcacctggagctg
cacgtggacgacccctggcagaccatgacccacatccgccacgccggggccatttttctg
ggcgcgtactcgtccgagcccgtgggcgactactttgcgggccccaaccacgtgctgccc
accggcggcacggcccgccacgcctccgcccttggggtcgacgacttcgtgcgcacgcag
tccgtcctctcctacacgaaggaccggctggacgagaccgggccgaagattgccaccatc
gccgaggcggaagacctgcaggcccacgccgaggcgatccggacacggctggatcgcgac
ggcgggtcgggttcgaaaaagccgtga

DBGET integrated database retrieval system