KEGG   Salinibacter ruber DSM 13855: SRU_2203Help
Entry
SRU_2203          CDS       T00312                                 

Definition
GDSL-like lipase/acylhydrolase domain-containing protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SRU_2203
Enzymes [BR:sru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SRU_2203
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SRU_2203
Lipid biosynthesis proteins [BR:sru01004]
 Fatty acid synthase
  Component type
   SRU_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2732735..2734462
Genome map
AA seq 575 aa AA seqDB search
MGHPETGSFRRALCSPRKTRRGVRIAPGAPGALRVRFRASETGARPADSPLGDAGRFRHL
FVVDDLPATEVEDAFRAGGQLLVVRHQDERRAGGLVQLEEKILDPTGRLGVEVAGRLVGE
EHAGAVDEGPRHGHPLALAPRELRGVVVEPVAQPHLVEQIGGPGARVGIAPQLGRHHHVL
QGRQRREQAEGLEDEPDVSVAHLGTLVFVEGREVDATKLHAPARRLVEAGAQPQQGRLAT
ARRADDGAGVALVHRKAHVVNHRQGAPPAGKRLRQGLDLENGGLAHGREEESLRNERGCS
VGRRCPGNPAASVSVRRAEAIPRSFRRCPAACMSTIRLYLFLLVGVLGLVGCGQDRSTSA
PAASSADTTQSPPASGAADTTDAEARVLVLGNSIAAGSGVSSREAFPARLQQKVDSLGWD
VQVQNAGVSGETTAGGLQRIGWVLQRPVDVLVLELGGNDGLRGIDPGVTRKNLRGIIDTT
LSTYPEARVLLTGMQVPPNLGPEYARQFRQVYPAVAEAYDRVTLIPFLLNDIAGSDSLMQ
DDGIHPTAAGHRLIANEIWTDLRPLLEERRPQDPA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtggggcatccagagaccggttctttccgtcgagccctctgttccccgcggaaaacgaga
cggggcgtccgcattgcccccggtgccccaggcgccctgcgtgtccgtttccgggcgtcg
gagaccggcgcccggccggcagacagcccgctaggcgacgccggccggttccgacacctg
ttcgtcgtcgacgacctgcccgccacggaggtggaggatgcgttccgtgcgggcggccag
ctcctggtcgtgcgacaccaggacgagcgtcgtgccggcggtctcgttcagctcgaagag
aagatcctcgatccgaccggccgtctcggcgtcgaggttgccggtcggctcgtcggcgaa
gagcacgcgggggcggttgatgaaggcccgcgccatggccacccgctggcgctcgccccc
cgagagctgcgtggggtagtggtcgagccggtcgcccagccccacctcgtcgagcaaatc
ggcggcccgggtgcgcgggtcggcatcgccccgcagctcggccggcaccatcacgttctc
cagggccgtcagcgtcgggagcaggcggaaggtctggaagacgaacccgacgtttcggtt
gcgcacctcggcacgctcgtcttcgtcgaggggcgtgaggtcgacgccacaaagctccac
gcgcccgctcgtcggctggtcgaggccggcgcacagccccagcagggtcgtcttgccact
gcccgacgggccgacgatggagcaggtgtcgccctcgttcaccgaaaagctcacgtcgtc
aatcaccgtcagggtgcgccccccgctgggaaacgtcttcgtcagggactcgacctggag
aacggaggtctcgctcatgggcgcgaagaagaatcgttgcgaaatgagagagggtgcagt
gtcggacgacgatgccccggaaaccctgctgcgtcggtttcggttcggcgagccgaagcg
attccccgctctttccgacgctgccccgccgcgtgtatgtcgaccatccgtctatacctg
tttctgctcgtaggggttctgggcctggtgggctgcgggcaagatcgttccacttcggcg
cccgccgcctcgtcggccgacacgacccagtccccgccggcgtcgggcgcggcggacacg
accgacgcggaggcgcgcgtgctggtcctcggcaacagcatcgccgccgggtccggcgtg
tcgtcccgggaggcgtttcccgcccgtctccagcagaaggtcgactccctcgggtgggac
gtacaggttcaaaacgcgggggtgagcggggagaccacggccgggggcctgcagcgcatc
gggtgggtgttgcagaggccggtggacgtgctcgtgctggagctgggggggaacgacggc
ctgcggggcatcgacccgggcgtcacccgcaagaacctgcgcggcattatcgacacgacc
ctgagcacgtacccggaggcccgcgtcctcctgacggggatgcaggtgcccccgaacctc
gggccggagtacgcccggcagttccgccaggtctacccggcggtcgccgaggcgtacgac
cgcgtcacgctgattccgttcctcctcaatgacatcgcggggtccgattccctaatgcag
gacgacggcatccatcccaccgcggccggccaccgcctcatcgcaaacgagatctggacc
gacctccggcccctcctggaagagaggcgcccccaggacccagcgtga

DBGET integrated database retrieval system