KEGG   Salinibacter ruber DSM 13855: SRU_2320Help
Entry
SRU_2320          CDS       T00312                                 

Definition
magnesium chelatase subunit ChlI family protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SRU_2320
Enzymes [BR:sru01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SRU_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2889645..2891219)
Genome map
AA seq 524 aa AA seqDB search
MNRRSSMALTDRTTLGELKEADYQVRSVKDELRANLMQKLRAGEEVFPGILGYDETVIPR
IQNAILAKHDLILLGLRGQAKSRLIRMLPRLLDDHIPVIEDTPLNEDPFNPITKQGRAIV
EERGDDTPIEWLPREARYGEKLATPDTTIADLIGDIDPIKAANERLTYADEEVIHFGIVP
RTNRGIFAINELPDLQPRIQVGLFNIMEEQDIQIRGFNVRFPLDVMMVFSANPEDYTSRG
NLVTPLKDRIDSQITTHYPKTIETGMSITEQEAWQDRADGAAAVDVHIPRFFREIVEQVA
FEARESEYIDQTSGVSVRVTRAALEALISAAERRALLNGEDETTVRVSDLMHVAPAITGK
VELVYEGEQEGAEEVALTLIGRAVRALFDEYFPDPSDKEEGRPEYKDVLDWFAQGRSIDL
DQDMSDAAYAETLGQIDGLQALAEEYLSPDTTGETHTGMEFVVESLHQHSLVGKEISDGG
QTYDDIMGSMLSSIGDGGVPGDDFDEGDFDDDDDDTDDPLSRYR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccgctcctccatggcccttaccgaccgcacgacgcttggcgaactcaaagag
gccgactatcaggtccgctccgtgaaggacgaactgcgggccaatctgatgcagaagctc
cgtgccggcgaggaggtctttcccggcattctgggctacgacgagaccgtcattccgcgg
attcagaatgccatcctcgcgaagcacgacctcattcttttggggctgcgcgggcaggcc
aagagccgcctcatccgcatgctgccgcggctcctcgacgaccacattccggtgatcgag
gacacacccctcaacgaggatcccttcaatccgatcaccaagcaggggcgcgcaatcgtg
gaggagcggggcgacgacacgccgatcgagtggctgccccgggaggcgcgctacggcgag
aagctggcgacgccggacaccacgatcgccgacctcatcggcgacatcgaccccatcaag
gccgccaacgagcggctcacctacgccgacgaggaggttatccacttcggcatcgtgccg
cgcaccaaccgcggcattttcgccatcaacgagctgccggacctccagccgcggattcag
gtgggcctcttcaacatcatggaggagcaggacattcagatccgcggcttcaacgtgcgc
ttcccgctcgacgtgatgatggtcttctccgccaacccggaggactacaccagccgcggc
aacctcgtgacgccgctcaaggaccgcatcgacagccaaatcacgacccattacccgaag
acgatcgagacgggcatgtccattaccgagcaggaggcgtggcaggaccgcgccgacggg
gcggcggcggtggacgtgcacatcccgcgcttcttccgcgaaatcgtcgagcaggtggcg
ttcgaggcgcgcgagagcgagtacatcgaccagacctccggggtctcggtccgtgtgacg
cgggcggcgctggaggcgctcatctccgcggccgagcggcgggcgcttctcaacggcgag
gacgagacgaccgtccgcgtcagcgacctgatgcacgtggccccggccatcaccggcaag
gtggagctcgtctacgagggggagcaggagggtgccgaagaggtggcgctcacgctgatc
gggcgggccgtccgggcgctcttcgacgagtacttccccgacccgagcgacaaggaagag
ggccgtcccgagtacaaggacgtgctcgactggtttgcgcagggccgctccatcgacctg
gaccaggacatgagcgacgcggcgtacgcggagacgctcgggcagatcgacggcctccag
gcgcttgcggaggagtacctctcgccggacacgaccggcgagacccacacgggcatggag
ttcgtcgtggagtcgctccaccagcactcgctcgtgggcaaagagattagcgacggcggg
cagacctacgacgacatcatgggctcgatgctctcctccatcggcgacggcggcgtgccg
ggcgatgacttcgacgagggcgacttcgacgacgatgacgacgacaccgacgacccgttg
agtcggtaccggtag

DBGET integrated database retrieval system