KEGG   Salinibacter ruber DSM 13855: SRU_2377Help
Entry
SRU_2377          CDS       T00312                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SRU_2377 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRU_2377 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SRU_2377 (thrC)
Enzymes [BR:sru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SRU_2377 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2956014..2957330)
Genome map
AA seq 438 aa AA seqDB search
MSTRTPAHRVSLSTALQDGLAPDGGLYVPERFPTLGPEAFAGCTTIEAVAERLLRPFAEG
DGLADVLPGICEAMFGFPVPLREIGRGTSVLELFHGPTAAFKDVGARFLADSLARLNEGA
AQPLTILVATSGDTGAAVAAAFWKKPNVEVVVLYPKGKVSDRQEQQLTGWSDNVQTVAVR
GVFDDCQTLVKEAFQDEAWQERLRLSSANSINIGRLLPQMTYYAYASLRHWRAHGTRPNV
IVPSGNLGNGLACLYARECGLPIGEVVFATNENRPVTHYLETGEYEAFETQETLATAMDV
GNPSNMERLRHHYSGSGGAEALHDAIGAERVTDEQIERHVRQGPEAWDTVWDPHTATAVE
AREHLDPDDEHEWILVATAHPAKFPEVVEPLVGHAVDVPEPLAEVMARSHPVPEVDPTLS
AVADVVFEDRRPDATEHA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacccgcacccccgcccatcgcgtttccctctccacggcgctgcaggacggactg
gcgccggacggggggctgtacgtgcccgaacggtttccgaccctcgggcccgaggcgttt
gcgggatgcaccacgatcgaggcggtggcggagcggcttctgcgcccgtttgcggagggg
gacggcctggcggacgtgctgccggggatctgcgaggcgatgtttggctttccggtgccg
ctgcgcgagatcggccgggggacgagcgtcctcgaactcttccacggccccacggcggcg
tttaaggacgtgggggcgcgcttcctggccgacagccttgcccgtctcaacgaaggggcc
gcgcagccgcttaccatcctcgtggccacctccggcgacaccggcgcggccgtggcggcg
gccttctggaagaagcccaacgtcgaggtcgtcgtcctctacccgaagggcaaggtgtcc
gaccggcaggagcagcagctcaccgggtggagcgacaacgtgcagaccgtggccgtccgc
ggcgtgtttgacgactgccagacgctcgtgaaggaggcctttcaggacgaggcgtggcag
gagcgcctgcgcctctcctccgccaacagcatcaacatcgggcgtctgctgccgcagatg
acgtactacgcctacgccagcctccggcactggcgcgcccacggcacccgccccaacgtg
atcgtgccgtccggcaacctgggcaacgggctcgcctgcctgtacgcccgcgagtgcggg
ctgccgattggggaggtcgtcttcgcgacgaacgagaaccgccccgtcacgcactacctg
gagaccggcgagtacgaggcgtttgagacgcaggaaaccctggcgacggcgatggacgtg
ggcaatcccagcaacatggagcgcctgcgccaccactattccggcagcggtggagcggag
gcactgcacgatgccatcggcgccgagcgcgtcaccgacgagcagatcgaacggcacgtc
cgccaggggcccgaggcctgggacacggtgtgggacccccacacggccaccgcggtcgag
gcccgcgagcatctcgaccccgacgacgagcacgagtggatcctggtggccaccgcgcac
ccggccaagtttccggaggtggtggagccgctcgtggggcacgcggtcgacgtgcccgaa
ccactggccgaggtgatggcgcggtcgcatcccgtccccgaggtggacccgacgctctcg
gcggtggcggacgtggtgttcgaggaccgcaggcccgacgcgacggagcacgcgtag

DBGET integrated database retrieval system