KEGG   Salinibacter ruber DSM 13855: SRU_2377Help
Entry
SRU_2377          CDS       T00312                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00260  Glycine, serine and threonine metabolism
sru00750  Vitamin B6 metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01230  Biosynthesis of amino acids
Module
sru_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRU_2377 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SRU_2377 (thrC)
Enzymes [BR:sru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SRU_2377 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 3853199
NCBI-ProteinID: YP_446477
UniProt: Q2S004
Position
complement(2956014..2957330)
Genome map
AA seq 438 aa AA seqDB search
MSTRTPAHRVSLSTALQDGLAPDGGLYVPERFPTLGPEAFAGCTTIEAVAERLLRPFAEG
DGLADVLPGICEAMFGFPVPLREIGRGTSVLELFHGPTAAFKDVGARFLADSLARLNEGA
AQPLTILVATSGDTGAAVAAAFWKKPNVEVVVLYPKGKVSDRQEQQLTGWSDNVQTVAVR
GVFDDCQTLVKEAFQDEAWQERLRLSSANSINIGRLLPQMTYYAYASLRHWRAHGTRPNV
IVPSGNLGNGLACLYARECGLPIGEVVFATNENRPVTHYLETGEYEAFETQETLATAMDV
GNPSNMERLRHHYSGSGGAEALHDAIGAERVTDEQIERHVRQGPEAWDTVWDPHTATAVE
AREHLDPDDEHEWILVATAHPAKFPEVVEPLVGHAVDVPEPLAEVMARSHPVPEVDPTLS
AVADVVFEDRRPDATEHA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacccgcacccccgcccatcgcgtttccctctccacggcgctgcaggacggactg
gcgccggacggggggctgtacgtgcccgaacggtttccgaccctcgggcccgaggcgttt
gcgggatgcaccacgatcgaggcggtggcggagcggcttctgcgcccgtttgcggagggg
gacggcctggcggacgtgctgccggggatctgcgaggcgatgtttggctttccggtgccg
ctgcgcgagatcggccgggggacgagcgtcctcgaactcttccacggccccacggcggcg
tttaaggacgtgggggcgcgcttcctggccgacagccttgcccgtctcaacgaaggggcc
gcgcagccgcttaccatcctcgtggccacctccggcgacaccggcgcggccgtggcggcg
gccttctggaagaagcccaacgtcgaggtcgtcgtcctctacccgaagggcaaggtgtcc
gaccggcaggagcagcagctcaccgggtggagcgacaacgtgcagaccgtggccgtccgc
ggcgtgtttgacgactgccagacgctcgtgaaggaggcctttcaggacgaggcgtggcag
gagcgcctgcgcctctcctccgccaacagcatcaacatcgggcgtctgctgccgcagatg
acgtactacgcctacgccagcctccggcactggcgcgcccacggcacccgccccaacgtg
atcgtgccgtccggcaacctgggcaacgggctcgcctgcctgtacgcccgcgagtgcggg
ctgccgattggggaggtcgtcttcgcgacgaacgagaaccgccccgtcacgcactacctg
gagaccggcgagtacgaggcgtttgagacgcaggaaaccctggcgacggcgatggacgtg
ggcaatcccagcaacatggagcgcctgcgccaccactattccggcagcggtggagcggag
gcactgcacgatgccatcggcgccgagcgcgtcaccgacgagcagatcgaacggcacgtc
cgccaggggcccgaggcctgggacacggtgtgggacccccacacggccaccgcggtcgag
gcccgcgagcatctcgaccccgacgacgagcacgagtggatcctggtggccaccgcgcac
ccggccaagtttccggaggtggtggagccgctcgtggggcacgcggtcgacgtgcccgaa
ccactggccgaggtgatggcgcggtcgcatcccgtccccgaggtggacccgacgctctcg
gcggtggcggacgtggtgttcgaggaccgcaggcccgacgcgacggagcacgcgtag

DBGET integrated database retrieval system