KEGG   Salinibacter ruber DSM 13855: SRU_2377Help
Entry
SRU_2377          CDS       T00312                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SRU_2377 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SRU_2377 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SRU_2377 (thrC)
Enzymes [BR:sru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SRU_2377 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2956014..2957330)
Genome map
AA seq 438 aa AA seqDB search
MSTRTPAHRVSLSTALQDGLAPDGGLYVPERFPTLGPEAFAGCTTIEAVAERLLRPFAEG
DGLADVLPGICEAMFGFPVPLREIGRGTSVLELFHGPTAAFKDVGARFLADSLARLNEGA
AQPLTILVATSGDTGAAVAAAFWKKPNVEVVVLYPKGKVSDRQEQQLTGWSDNVQTVAVR
GVFDDCQTLVKEAFQDEAWQERLRLSSANSINIGRLLPQMTYYAYASLRHWRAHGTRPNV
IVPSGNLGNGLACLYARECGLPIGEVVFATNENRPVTHYLETGEYEAFETQETLATAMDV
GNPSNMERLRHHYSGSGGAEALHDAIGAERVTDEQIERHVRQGPEAWDTVWDPHTATAVE
AREHLDPDDEHEWILVATAHPAKFPEVVEPLVGHAVDVPEPLAEVMARSHPVPEVDPTLS
AVADVVFEDRRPDATEHA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacccgcacccccgcccatcgcgtttccctctccacggcgctgcaggacggactg
gcgccggacggggggctgtacgtgcccgaacggtttccgaccctcgggcccgaggcgttt
gcgggatgcaccacgatcgaggcggtggcggagcggcttctgcgcccgtttgcggagggg
gacggcctggcggacgtgctgccggggatctgcgaggcgatgtttggctttccggtgccg
ctgcgcgagatcggccgggggacgagcgtcctcgaactcttccacggccccacggcggcg
tttaaggacgtgggggcgcgcttcctggccgacagccttgcccgtctcaacgaaggggcc
gcgcagccgcttaccatcctcgtggccacctccggcgacaccggcgcggccgtggcggcg
gccttctggaagaagcccaacgtcgaggtcgtcgtcctctacccgaagggcaaggtgtcc
gaccggcaggagcagcagctcaccgggtggagcgacaacgtgcagaccgtggccgtccgc
ggcgtgtttgacgactgccagacgctcgtgaaggaggcctttcaggacgaggcgtggcag
gagcgcctgcgcctctcctccgccaacagcatcaacatcgggcgtctgctgccgcagatg
acgtactacgcctacgccagcctccggcactggcgcgcccacggcacccgccccaacgtg
atcgtgccgtccggcaacctgggcaacgggctcgcctgcctgtacgcccgcgagtgcggg
ctgccgattggggaggtcgtcttcgcgacgaacgagaaccgccccgtcacgcactacctg
gagaccggcgagtacgaggcgtttgagacgcaggaaaccctggcgacggcgatggacgtg
ggcaatcccagcaacatggagcgcctgcgccaccactattccggcagcggtggagcggag
gcactgcacgatgccatcggcgccgagcgcgtcaccgacgagcagatcgaacggcacgtc
cgccaggggcccgaggcctgggacacggtgtgggacccccacacggccaccgcggtcgag
gcccgcgagcatctcgaccccgacgacgagcacgagtggatcctggtggccaccgcgcac
ccggccaagtttccggaggtggtggagccgctcgtggggcacgcggtcgacgtgcccgaa
ccactggccgaggtgatggcgcggtcgcatcccgtccccgaggtggacccgacgctctcg
gcggtggcggacgtggtgttcgaggaccgcaggcccgacgcgacggagcacgcgtag

DBGET integrated database retrieval system