KEGG   Salinibacter ruber DSM 13855: SRU_2409Help
Entry
SRU_2409          CDS       T00312                                 

Definition
glycosyl hydrolase family protein
Organism
sru  Salinibacter ruber DSM 13855
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3005509..3007251
Genome map
AA seq 580 aa AA seqDB search
MERPTVELMVYGENLATTRVEIGTHPGVTLDRVTEVENPNYLFVRLRIGDTATPGTIPLH
FRHDAGTLTRSFELRPRRTGTYAQGFSSEDVIYLLMPDRFANGAPENDSIPGFLEGVDRS
DPDARHGGDFAGIREHLDYIDDLGMTALWMTPIFENDMPPEYGAYHGYAATDMYRVDPRF
GSNDTFRRLVESAHERDLKVIMDMIHNHIGDRHWWMDDPPTGDWVHDFDKYGTTNYEGAA
VIDPYAAEHDREQLTDAWFVPSMPDLNQDNELLATYLIQNTLWWIESTGIDGIRMDTYFY
ADKDYMTRWTSAVLEEYPDFNIVGESWVPTVPHEAYWQDDFQAHPDDYDSDLPSVTDFPL
SFAMQDAFAPDGGGVYDLYRTLAQDHVYPAPNKLVTFLDNHDLTRFFSVVDEDEDAFKLA
YAFLMTTRGIPQVYYATELMQPMLDVEGDGAKRPDMPGGWPGDARSVFTEEGRTARENRA
HDFVTTLTTWREDADVVHHGGLTHYIPQDDTYVYFRHDADDTVMVVLNNAEESRTLALDR
FEERIQGHTAGRDVISGATVALGDSLTVPARTPMVLELRK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagcggccgaccgtcgagctgatggtctacggcgagaacctcgccacgacgcgagtg
gagattgggactcaccccggcgtgacgctggaccgggtgacggaggtcgagaaccccaac
tatcttttcgttcgcctccgcatcggcgacacggccacgcccggcacgatcccgctccac
ttccgccacgacgccgggacgctcacccgcagctttgaactccgcccgcgccgcaccggc
acatacgcccagggcttctccagtgaggacgtgatctacctcctcatgccggatcggttc
gcaaacggcgcccccgaaaacgactcgatccccggctttttggagggggtcgaccgctcc
gaccccgacgcgcgccacggcggggacttcgccggcatccgcgagcacctcgactacatc
gacgacctgggcatgacggccctctggatgacgcccattttcgagaacgacatgcccccc
gaatacggcgcctaccacggctacgcggccaccgacatgtatcgggtggacccgcgcttc
gggagcaacgacacgttccggcggctcgtggaaagcgcccacgagcgggacctgaaggtg
atcatggacatgatccacaaccacatcggcgaccggcactggtggatggacgacccgccg
accggcgattgggtccacgacttcgacaaatacggcaccaccaactacgagggcgccgcc
gtcatcgacccgtacgccgccgagcacgaccgcgagcagctgacggacgcctggtttgtc
ccctccatgcccgacctcaaccaggacaacgagctgctcgccacctacctgattcagaac
acgctctggtggatcgagtcgaccggcatcgacggcatccggatggacacctacttctac
gccgacaaggactacatgacgcgctggacgtcggccgtgctggaggagtaccccgacttc
aacatcgtgggcgagagctgggtgcccaccgtgccccacgaggcctactggcaggacgac
ttccaggcccaccccgacgactacgactcggacctgccgagcgtcaccgacttcccgctc
agctttgcgatgcaggacgccttcgcccccgacggcgggggcgtctacgacctctaccgg
acgctcgcccaggaccacgtctaccccgcgcccaacaagctcgtgaccttcctcgacaac
cacgacctcacccggtttttctccgtcgtggacgaggacgaggacgccttcaagctggcg
tatgcatttctcatgaccacgcgcggcatcccgcaggtctactacgccaccgagctgatg
cagccgatgctggacgtggagggcgacggcgcgaagcggcccgacatgcccggcggctgg
cccggcgacgcgcggagcgtgttcaccgaggagggccgcacggcccgcgagaaccgggcg
cacgacttcgtgaccaccctgacgacgtggcgcgaggacgccgacgtggttcatcacggc
ggcctcacccactacatcccgcaggacgatacctacgtctacttccgccacgacgccgac
gacacggtgatggtcgtcctcaacaacgcagaggagtcgcgcaccctcgccctcgatcgc
ttcgaggagcgcatccagggccacacggcgggccgtgacgtgatcagcggggcgaccgtg
gcgctcggggactccctcacggtgcccgcacggaccccgatggtcttggagcttcggaag
tga

DBGET integrated database retrieval system