KEGG   Salinibacter ruber DSM 13855: SRU_2409Help
Entry
SRU_2409          CDS       T00312                                 

Definition
(RefSeq) glycosyl hydrolase family protein
  KO
K21575  
neopullulanase [EC:3.2.1.135]
Organism
sru  Salinibacter ruber DSM 13855
Brite
Enzymes [BR:sru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.135  neopullulanase
     SRU_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3005509..3007251
Genome map
AA seq 580 aa AA seqDB search
MERPTVELMVYGENLATTRVEIGTHPGVTLDRVTEVENPNYLFVRLRIGDTATPGTIPLH
FRHDAGTLTRSFELRPRRTGTYAQGFSSEDVIYLLMPDRFANGAPENDSIPGFLEGVDRS
DPDARHGGDFAGIREHLDYIDDLGMTALWMTPIFENDMPPEYGAYHGYAATDMYRVDPRF
GSNDTFRRLVESAHERDLKVIMDMIHNHIGDRHWWMDDPPTGDWVHDFDKYGTTNYEGAA
VIDPYAAEHDREQLTDAWFVPSMPDLNQDNELLATYLIQNTLWWIESTGIDGIRMDTYFY
ADKDYMTRWTSAVLEEYPDFNIVGESWVPTVPHEAYWQDDFQAHPDDYDSDLPSVTDFPL
SFAMQDAFAPDGGGVYDLYRTLAQDHVYPAPNKLVTFLDNHDLTRFFSVVDEDEDAFKLA
YAFLMTTRGIPQVYYATELMQPMLDVEGDGAKRPDMPGGWPGDARSVFTEEGRTARENRA
HDFVTTLTTWREDADVVHHGGLTHYIPQDDTYVYFRHDADDTVMVVLNNAEESRTLALDR
FEERIQGHTAGRDVISGATVALGDSLTVPARTPMVLELRK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagcggccgaccgtcgagctgatggtctacggcgagaacctcgccacgacgcgagtg
gagattgggactcaccccggcgtgacgctggaccgggtgacggaggtcgagaaccccaac
tatcttttcgttcgcctccgcatcggcgacacggccacgcccggcacgatcccgctccac
ttccgccacgacgccgggacgctcacccgcagctttgaactccgcccgcgccgcaccggc
acatacgcccagggcttctccagtgaggacgtgatctacctcctcatgccggatcggttc
gcaaacggcgcccccgaaaacgactcgatccccggctttttggagggggtcgaccgctcc
gaccccgacgcgcgccacggcggggacttcgccggcatccgcgagcacctcgactacatc
gacgacctgggcatgacggccctctggatgacgcccattttcgagaacgacatgcccccc
gaatacggcgcctaccacggctacgcggccaccgacatgtatcgggtggacccgcgcttc
gggagcaacgacacgttccggcggctcgtggaaagcgcccacgagcgggacctgaaggtg
atcatggacatgatccacaaccacatcggcgaccggcactggtggatggacgacccgccg
accggcgattgggtccacgacttcgacaaatacggcaccaccaactacgagggcgccgcc
gtcatcgacccgtacgccgccgagcacgaccgcgagcagctgacggacgcctggtttgtc
ccctccatgcccgacctcaaccaggacaacgagctgctcgccacctacctgattcagaac
acgctctggtggatcgagtcgaccggcatcgacggcatccggatggacacctacttctac
gccgacaaggactacatgacgcgctggacgtcggccgtgctggaggagtaccccgacttc
aacatcgtgggcgagagctgggtgcccaccgtgccccacgaggcctactggcaggacgac
ttccaggcccaccccgacgactacgactcggacctgccgagcgtcaccgacttcccgctc
agctttgcgatgcaggacgccttcgcccccgacggcgggggcgtctacgacctctaccgg
acgctcgcccaggaccacgtctaccccgcgcccaacaagctcgtgaccttcctcgacaac
cacgacctcacccggtttttctccgtcgtggacgaggacgaggacgccttcaagctggcg
tatgcatttctcatgaccacgcgcggcatcccgcaggtctactacgccaccgagctgatg
cagccgatgctggacgtggagggcgacggcgcgaagcggcccgacatgcccggcggctgg
cccggcgacgcgcggagcgtgttcaccgaggagggccgcacggcccgcgagaaccgggcg
cacgacttcgtgaccaccctgacgacgtggcgcgaggacgccgacgtggttcatcacggc
ggcctcacccactacatcccgcaggacgatacctacgtctacttccgccacgacgccgac
gacacggtgatggtcgtcctcaacaacgcagaggagtcgcgcaccctcgccctcgatcgc
ttcgaggagcgcatccagggccacacggcgggccgtgacgtgatcagcggggcgaccgtg
gcgctcggggactccctcacggtgcccgcacggaccccgatggtcttggagcttcggaag
tga

DBGET integrated database retrieval system