KEGG   Salinibacter ruber DSM 13855: SRU_2490Help
Entry
SRU_2490          CDS       T00312                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SRU_2490
Enzymes [BR:sru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SRU_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3094917..3095987)
Genome map
AA seq 356 aa AA seqDB search
MTDDAKSFFFDLLDTPSPTGFEAPGQRVWTEYVRDHADAVEADAYGTAWARLEGTADDAP
SVMLDAHADEIGFMVRHITDDGFIHINRIGGSDRAIARGLRVRILGDDGPVTGVVGNTAI
HIRDTKNEKVPKVHELFVDIGAEDEEEVHDRGIRVGHPMVFDVGPTELTDTRITARAIDN
RLGGFILAQAVARLAEERPAWQVQAANSVQEEIGGHGAKMITHRLDPDAAIAFDVTHATD
SPGISSTKHGDVELGAGPTVTHGTSNHPQLVERVIEVADAEDIPLQHEPSSRRTGTDTDS
IFKTRSGVPSVLLSVPLRYMHSTVEVADTEDIEHCVQLYAALVRSFGADEEFSVSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgcgaaatcgttcttcttcgatcttctggacaccccgagccccaccggc
tttgaggcgcccgggcagcgcgtgtggaccgagtacgtgcgcgaccacgccgacgcggtg
gaggccgacgcgtacggcacggcctgggcccgcctggagggcacggccgacgatgccccg
agcgtcatgctcgacgcgcacgccgacgagatcgggttcatggtgcgccacatcaccgac
gacggcttcatccacatcaaccgcatcggcggctccgaccgcgccatcgcgcgggggctg
cgtgtgcgcatcctcggggacgacgggccggtcaccggcgtggtgggcaacacggccatc
cacatccgcgacaccaagaacgaaaaggtgcccaaggtgcacgagctgttcgtggacatc
ggggccgaggacgaggaggaggtgcacgaccgcggcatccgggtgggccacccgatggtg
ttcgacgtgggcccgaccgagctgaccgacacccgcatcaccgcccgcgccatcgacaac
cgactcggcggcttcatcctcgcgcaggccgtggcgcggctggcggaggagcgcccggcg
tggcaggtgcaggcggccaactcggtgcaggaagaaattggggggcacggggcgaagatg
attacgcaccgcctcgatccggacgccgcgatcgcgttcgacgtgacccacgccaccgac
tcgccgggcatcagcagcaccaagcacggcgacgttgagctcggggcggggccgaccgtg
acgcacggcacgtccaaccacccgcagctcgtggagcgcgtcatcgaggtggccgacgcc
gaggacattccgctccagcacgagccgagcagccgccgcaccggcaccgacaccgactcc
atcttcaagacccgcagcggcgtgcccagtgtgcttctgtccgtgccgctccgctacatg
cactcgaccgtcgaggtggccgacaccgaagacatcgagcactgcgtgcagctctacgcg
gcgctcgtgcgttccttcggggcggacgaggagtttagcgtctcgctgtag

DBGET integrated database retrieval system