KEGG   Salinibacter ruber DSM 13855: SRU_2490Help
Entry
SRU_2490          CDS       T00312                                 

Definition
(RefSeq) endoglucanase
Organism
sru  Salinibacter ruber DSM 13855
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(3094917..3095987)
Genome map
AA seq 356 aa AA seqDB search
MTDDAKSFFFDLLDTPSPTGFEAPGQRVWTEYVRDHADAVEADAYGTAWARLEGTADDAP
SVMLDAHADEIGFMVRHITDDGFIHINRIGGSDRAIARGLRVRILGDDGPVTGVVGNTAI
HIRDTKNEKVPKVHELFVDIGAEDEEEVHDRGIRVGHPMVFDVGPTELTDTRITARAIDN
RLGGFILAQAVARLAEERPAWQVQAANSVQEEIGGHGAKMITHRLDPDAAIAFDVTHATD
SPGISSTKHGDVELGAGPTVTHGTSNHPQLVERVIEVADAEDIPLQHEPSSRRTGTDTDS
IFKTRSGVPSVLLSVPLRYMHSTVEVADTEDIEHCVQLYAALVRSFGADEEFSVSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgcgaaatcgttcttcttcgatcttctggacaccccgagccccaccggc
tttgaggcgcccgggcagcgcgtgtggaccgagtacgtgcgcgaccacgccgacgcggtg
gaggccgacgcgtacggcacggcctgggcccgcctggagggcacggccgacgatgccccg
agcgtcatgctcgacgcgcacgccgacgagatcgggttcatggtgcgccacatcaccgac
gacggcttcatccacatcaaccgcatcggcggctccgaccgcgccatcgcgcgggggctg
cgtgtgcgcatcctcggggacgacgggccggtcaccggcgtggtgggcaacacggccatc
cacatccgcgacaccaagaacgaaaaggtgcccaaggtgcacgagctgttcgtggacatc
ggggccgaggacgaggaggaggtgcacgaccgcggcatccgggtgggccacccgatggtg
ttcgacgtgggcccgaccgagctgaccgacacccgcatcaccgcccgcgccatcgacaac
cgactcggcggcttcatcctcgcgcaggccgtggcgcggctggcggaggagcgcccggcg
tggcaggtgcaggcggccaactcggtgcaggaagaaattggggggcacggggcgaagatg
attacgcaccgcctcgatccggacgccgcgatcgcgttcgacgtgacccacgccaccgac
tcgccgggcatcagcagcaccaagcacggcgacgttgagctcggggcggggccgaccgtg
acgcacggcacgtccaaccacccgcagctcgtggagcgcgtcatcgaggtggccgacgcc
gaggacattccgctccagcacgagccgagcagccgccgcaccggcaccgacaccgactcc
atcttcaagacccgcagcggcgtgcccagtgtgcttctgtccgtgccgctccgctacatg
cactcgaccgtcgaggtggccgacaccgaagacatcgagcactgcgtgcagctctacgcg
gcgctcgtgcgttccttcggggcggacgaggagtttagcgtctcgctgtag

DBGET integrated database retrieval system