KEGG   Salinibacter ruber DSM 13855: SRU_2555Help
Entry
SRU_2555          CDS       T00312                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sru03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3177216..3177929)
Genome map
AA seq 237 aa AA seqDB search
MQYTSESVETLVEQFTKLPTIGKKTARRLANYVLKMPQEEVETIANALTSVKEDVQRCST
CYVVADQDPCPICGSDKRDASTICVVEESSDLTAIEQTNEYRGVYHVLGGVISPLDGVGP
DDLRVHELATRIDPSFEDTAADAAPEPNTTPDGEADAEAPPSENGGADEAESGVDEVILA
VNPNVEGDTTAYYISQLLEPFDVRVTRIARGLPIGGDLEYADEATLSRALEGRGHVD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacctcggagtccgtcgaaaccctcgtggagcagttcacgaagctgcccacg
atcgggaagaagacggcgcggcgactggccaactacgtcctgaagatgccccaggaggag
gttgagaccatcgcgaacgcgttgacgtccgtgaaggaggacgtgcaacgctgttcgacg
tgctacgtcgtggcggatcaggatccgtgccccatctgcggctcggacaagcgcgacgcc
tcgacgatttgtgtcgtggaggagtcgagcgacctgaccgccatcgagcagaccaacgag
taccggggcgtgtaccacgtgctcggcggggtcatttcgccgctcgacggcgtgggcccc
gacgacctccgggtgcacgagctggccacccgcatcgacccgtccttcgaagacacggcg
gccgatgcggctccggagcccaacaccacgcctgatggcgaagcggacgccgaggcgcct
ccctcggaaaatggcggggcggacgaggcggaatcgggggtcgacgaggtgattctcgcc
gtcaaccccaacgtcgagggcgacacgacggcatactacatctcccagcttcttgagccg
ttcgacgttcgcgtcacgcgcatcgcgcggggactgcccatcggcggggatctggagtac
gccgacgaggcgaccctctcgcgggcgctggaggggcgcgggcacgtcgactag

DBGET integrated database retrieval system