KEGG   Salinibacter ruber DSM 13855: SRU_2794Help
Entry
SRU_2794          CDS       T00312                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00790  Folate biosynthesis
sru01100  Metabolic pathways
Module
sru_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRU_2794 (folE)
Enzymes [BR:sru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SRU_2794 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 3853073
NCBI-ProteinID: YP_446886
UniProt: Q2RYU5
Position
3453226..3453825
Genome map
AA seq 199 aa AA seqDB search
MPPKLYERRDIYDEETSEALSEHIEAILDILGEDADREGLADTPERVARAYQFLMHGYAL
DPKDILRQALFEEAYDEMILVKDIEVYSMCEHHMLPFYGKAHVAYIPDGQIVGLSKIPRT
VEVFARRLQVQERLTLQIRNAIDEVVDPMGTAVVIEAKHLCMMMRGAEKQNSATTTSSVS
GEFNNHATRDEFMRLIDAE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaactctacgagcggcgcgacatctacgacgaagagacctccgaggccctc
agcgagcacatcgaggccatcctcgacatcctgggcgaagacgcagaccgggaggggctc
gccgacacccccgagcgcgtcgcccgcgcctatcagtttttgatgcacgggtacgccctc
gacccgaaggacatcctgcgccaggccctcttcgaagaggcctacgacgagatgattctc
gtcaaggacatcgaggtgtactcgatgtgcgagcaccacatgctgccgttttacggcaag
gcccacgtggcctacatcccggacggccagattgtgggactcagcaaaatcccgcggacg
gtcgaggtcttcgcccggcgcctgcaggtgcaggagcgccttacgctccagatccgaaac
gccatcgacgaggtggtcgaccccatgggcacggctgtcgtcatcgaggcgaagcacctc
tgcatgatgatgcggggggccgaaaagcagaactcggcgaccaccaccagctcggtgagc
ggcgagtttaacaatcacgccacccgggacgagttcatgcgcttgatcgacgccgagtag

DBGET integrated database retrieval system