KEGG   Sinocyclocheilus rhinocerous: 107733544Help
Entry
107733544         CDS       T04916                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107733544
Peptidases [BR:srx01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107733544
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107733544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 384 aa AA seqDB search
MRKRKGSADHDSSFTGNVTLLDGSSDLKQCHKKTDAASDPGGSGTGMGRRYRRGGLIWRL
RRILIWVLGIYIAIPVIIKVCPSIQAKLVFLNFVRVPYFIDLKRPEDQGLNHTRNFYLQP
EEGINIGVCHTVPSVMWREAQAKDAEWYDKSFQSSHPVILYLHGNAGTRGGDHRVQLYKV
LSSLGYHVVTFDYRGWGDSEGSPSEKGMTSDALFLYQWIKQRIGQKPLYIWGHSLGTGVA
TNLVRRLCDRGTPPDALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDSITANDIRF
ASDENVNHISCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFPSSLGYRH
KFIYKSPQLPNILSDFLSAPHPHV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcgaaaaggcagcgcagaccatgacagctcgttcacgggtaacgttacacta
ctggacggcagctccgatctaaagcagtgccacaaaaaaacagacgctgcttctgatcca
ggaggttcggggacagggatggggagacgctacaggaggggtggtctgatatggaggcta
aggaggatactgatctgggtgctgggaatctacatcgccatccctgttatcatcaaagtc
tgtccatcaatacaagcaaaattagtatttttaaactttgtgcgagtgccgtattttata
gatctgaagagaccagaggatcagggcttgaatcacactcgcaacttctacctgcagccc
gaggagggaatcaacattggagtgtgtcacacagtaccttcagtgatgtggagggaggct
caggcaaaagatgctgaatggtatgacaaaagcttccagtccagtcatccagtcatcctg
tatcttcatggcaatgctggaacaagaggaggggatcacagggttcagctgtacaaggtt
cttagttcattaggctaccatgtagtcacatttgattatagaggttggggtgactctgag
ggcagcccttcggagaaaggcatgacgtcagatgctctcttcctctaccagtggataaag
cagcggattggccagaagcccctgtacatctggggtcactcgcttggcacaggagtggcc
actaacctagtgagacgtctgtgtgacaggggaacgcccccagacgccctaattttagag
tcaccctttaccaatatcagagaggaagccaagagccatcccttctctatggtttacaga
tatctgccaggctttgactggttcttcctggattctataactgcgaatgatatccgattt
gccagtgatgaaaatgtcaaccacatatcctgtccggttctgatactgcacgcagaagat
gacacagtcgtacctttccagctgggaaagaagctatatgatttggcggctcagagcaag
agtctgaacggtcataaggttcagttcatcccgtttcccagctctctgggctacagacac
aagttcatctacaagagcccacagctaccaaatatactcagtgattttctcagtgcgccg
catcctcacgtgtag

DBGET integrated database retrieval system