KEGG   Serratia plymuthica S13: M621_00290Help
Entry
M621_00290        CDS       T02716                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sry  Serratia plymuthica S13
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sry00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M621_00290
   00051 Fructose and mannose metabolism
    M621_00290
Enzymes [BR:sry01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     M621_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(65867..67186)
Genome map
AA seq 439 aa AA seqDB search
MQSYFDQLEQVRYEGPDSNNPLAFRHYNPDELVLGKRMADHLRFAACYWHTFCWNGADMF
GVGAFDRPWQQPGDALALAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLNNFA
VMTDVLAEKQQSSGVKLLWGTANCFTHPRYGAGAATNPDPEVFSWAATQVFTAMNATHRL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVDANRG
DPQLGWDTDQFPNSVEENALVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAAKMTADGRLPQQVARRYAGWNGELGQQILQGKLSLEALAQYAEQHALAPQ
HASGRQEQLENLMNRYLFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcctattttgatcagcttgagcaagttcgctacgaaggccccgacagcaataac
ccgctggctttccgccactataatcccgatgagttggtactcggcaaacgtatggccgat
cacctgcgcttcgccgcctgttactggcacaccttctgctggaacggcgcggacatgttt
ggcgtcggggccttcgatcgcccctggcagcagccgggcgatgcgctggcgctggcaaaa
cgcaaggccgacgtggcgttcgaattcttccacaagctgaacgtgccttactattgcttc
catgacgtcgacgtgtcgccggaaggcgcttcgctgaaagaatatctgaataactttgcg
gtgatgaccgacgtgctggcggaaaagcagcaaagcagcggcgtgaagctgttgtggggc
accgccaactgctttacccatccgcgctacggcgcaggcgcggccaccaatccggatccg
gaagtgttcagttgggcggccacgcaggtattcaccgccatgaacgccactcatcgactg
ggcggcgagaactacgtgctgtggggcggacgcgaaggttacgaaaccctgctgaatacc
gatctgcgccaggagcgcgagcagattggccgctttatgcaaatggtggtggagcacaaa
cacaaaaccggtttccagggcacgctgctgatcgaacccaaaccgcaggaacccaccaag
caccagtacgactacgatgtcgccacggtgtacggcttcctgaagcagttcgggctggag
aaggagatcaaggtcaatatcgaggccaaccacgccaccctggccgggcactccttccac
catgaaatcgccaccgccatcgcgctcggcatcttcggctcagtcgacgccaaccgcggc
gatccgcagctgggctgggataccgatcagttccccaacagcgtggaggagaacgccctg
gtgatgttcgaaatcctcaaggccggcggattcaccaccggtggcctgaacttcgacgcc
aaggtccgccgccaaagcaccgacaaatacgatctgttctacggccatatcggtgcgatg
gacaccatggcgctggcgttgaaagtggcggccaaaatgaccgccgacggccggcttcct
cagcaggtcgcccgacgttacgccggctggaacggtgagctgggccagcaaattttgcag
ggcaaactgtcgctggaagccctggcgcagtacgctgaacaacatgcactggcgccgcag
cacgccagcggccgtcaggaacagcttgagaacctgatgaaccgctacctgttcggttaa

DBGET integrated database retrieval system