KEGG   Serratia plymuthica S13: M621_11290Help
Entry
M621_11290        CDS       T02716                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sry  Serratia plymuthica S13
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sry00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    M621_11290
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    M621_11290
Enzymes [BR:sry01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     M621_11290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2336273..2337598)
Genome map
AA seq 441 aa AA seqDB search
MNIEWITSSDTEQWQKCDRLLETIKPANLQLSKLRGRQVEGFGGCFNELGMTALNALDDK
QRHDILDNLFSPEGECRLTLGRVPIGASDYAVSWYSLNEQEEDYAMEHFSIERDKRYLLP
YIKEALARQPNMTLFASPWSPPTWLKTHQACNFGRLRQDERAQKAYALYFKKFIEHYENE
GVRIAQVHIQNEVVADQKFPSCVWSGEQLKEFIKEYLGPLFMQESIDSEIWLGTINAPEF
LKEPGQDYDDYANCVLSDPEAYQYVSGVGYQWAGKNAIQRTVMSYPELRYYQTESECGDG
NNSWQYAHYIFGLFRHYLVNGANGYFYWNMVLAEGGESTWGWKQNTMISINKETKSVSYN
PEYSVMRHFSRYVIPGARLIPLTGAMSGNTVAFENPDNSVIITINNPSFHKRELRLAIGK
RTLEFILHENSINTLIVKDYH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaatggatcacatcatctgatacggaacaatggcagaaatgcgaccgtctt
ctagaaacaattaaacccgctaacctgcagttgtccaagctccgtggtcgtcaggtggaa
gggttcggcgggtgcttcaatgaactggggatgacagcgttaaatgctctggacgacaaa
cagcggcacgacatcctggataacctgttttcaccagagggtgaatgtcggcttaccctg
ggacgcgtaccgatcggcgcaagtgattatgccgtatcctggtatagcctcaatgaacaa
gaggaagattacgccatggaacacttttccattgagcgtgacaaacgttatttattgcct
tatataaaagaggcacttgcgcgtcagccaaacatgacgctttttgcctccccctggagc
ccccccacttggctgaaaacacatcaagcctgtaattttggccgtcttcgccaggatgaa
cgggcgcaaaaagcttacgcattatattttaaaaaatttatcgaacactatgagaacgaa
ggtgtacgcatagcgcaggtacatattcaaaatgaagttgtcgccgatcaaaagttcccc
tcttgtgtctggagcggcgagcagttgaaagagtttataaaagagtatctcggcccactt
tttatgcaagaatctatagatagcgagatctggttaggaaccattaatgctccggagttt
ttgaaagagccggggcaagactatgatgactacgccaactgtgtactttccgaccccgaa
gcctaccaatatgttagcggcgtgggttatcagtgggccggtaagaatgccattcaacgc
accgtcatgagttaccctgaattacgctattaccaaacagaaagtgaatgtggtgatgga
aataatagctggcagtacgcgcactatatttttggtttgttccgacattacttagtcaat
ggtgccaacggctacttttactggaacatggtgttggctgaagggggagaaagtacctgg
ggttggaagcaaaacactatgatctccataaataaagaaacaaaatcagtaagttacaat
cctgagtatagcgttatgcgtcacttttctcgatacgttatacctggtgcccggctaatc
ccattaacaggtgcgatgagtggtaacaccgttgcgttcgaaaaccctgataactcggtc
atcatcacgataaataacccttcatttcataaaagagaactgaggcttgccattgggaaa
agaacccttgagtttatccttcatgaaaactcaataaatacattaatagtaaaagattac
cattaa

DBGET integrated database retrieval system