KEGG   Serratia plymuthica S13: M621_21130Help
Entry
M621_21130        CDS       T02716                                 

Gene name
mrcB
Definition
bifunctional glycosyl transferase/transpeptidase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
sry  Serratia plymuthica S13
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sry00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M621_21130 (mrcB)
Enzymes [BR:sry01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     M621_21130 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     M621_21130 (mrcB)
Glycosyltransferases [BR:sry01003]
 Polysaccharide
  Bacterial polysaccharide
   M621_21130 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4458286..4460790)
Genome map
AA seq 834 aa AA seqDB search
MAGDDREPIGRKGKQPKRTASGKPPRRRRDDDYDDYEEDEQQDDDDEYEDEEESVPRKVK
ATPPRKKRRWLGLLIKLILVVAVLLAIYGVYLDSQIRSRIDGKVWQLPAAVYGRMVNLEP
GMPYSKKEMVDLLEGMQYRQVSRMTRPGEFTVQANSIEMLRRPFDFPDGKEGQIHARLDF
QNNRLAKIENMENQRNFGFFRLDPRLITMLQSPNGEQRLFVPRAGFPDLLVDTLIATEDR
HFYEHDGISPYSIGRAMLANLTAGRAVQGGSTLTQQLVKNLFLTNERSLWRKVNEAYMAL
LVDYRYSKDRILELYLNEVYLGQSGSDQIRGFPLASLYYFGRPVDELSLDQQALLVGMVK
GASLYNPWRNPTLALERRNLVLKLLQNQGVIDAELYNMLSARPLGVQPKGGVITPQPAFM
QMVRQELQAKLGDKVNDLSGVKIFTTLDPVSQDAAEKAVEDGIPALRAARHLNDLEAAMV
IVDRFSGEVRAMVGGANPQFAGFNRAMQARRLVGSLAKPPTYLTALSEPDKYRLNTWLAD
QPLSLKLPNGSLWQPNNYDRKFRGQVMLVDGLAFSLNVPTVNLGMAVGLDQISATLQRLG
IPKAEINPVPSMLLGAIGLTPMEVAQEYQTIASGGNRAPLSAVRSVIAEDGSVLYQSFPQ
AERMVPAQAAYLTLYAMQQGVARGTSRSLSVKFPNYNLAAKTGTTNDLRDSWFAGIDGKE
VAIAWVGRDNNGPAKLTGANGALTLYRRYLENQTPLPLMLQPPEGINQIGIDSAGNFVCG
EGGRSIPVWTDNPQGLCQASQAAQQQQQQQQPAGEQKDADGVAGWIKDMFGQGQ
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggctggggatgaccgcgagcccatcgggcgcaaagggaaacaaccaaaacgcaccgcg
tcgggcaaaccgccgcgccgtcgccgagacgacgattatgacgattacgaggaagacgag
cagcaagatgacgatgatgaatatgaagacgaggaggaaagcgtgccgcgtaaggtaaaa
gcgactccgccgcgtaaaaaacgccgttggcttggcctgcttatcaaactgattctggtg
gtcgcggtgctgttggcgatctacggcgtgtacctggattcccagatccgcagccgcatt
gacggcaaggtctggcagttgccggccgcggtctatggccgcatggtcaacctggaaccg
ggcatgccgtacagcaagaaggaaatggtcgatctgctggaaggtatgcagtaccgccag
gttagccgcatgacccggccgggcgagttcaccgtgcaggccaacagcatcgagatgctg
cgtcgtccgtttgacttcccggatggcaaagaggggcaaatccatgcccgtctggatttc
cagaacaaccgtctggcgaaaatcgaaaacatggagaaccagcgtaacttcgggttcttc
cgcctcgatccgcgcctgatcaccatgttgcagtcaccgaacggtgaacagcgtctgttc
gtgccgcgcgccggtttcccggacctgctggtggatacgctgattgccaccgaagaccgc
catttctacgagcatgacggcatcagcccttactccattggccgtgcgatgctggcgaac
ctgaccgccgggcgtgcggtgcagggcggcagtaccctgacgcagcagttggtgaagaac
ctgttcctgaccaacgaacgctcgctatggcgtaaagtcaacgaagcctacatggcgctg
ctggtggattaccgttacagcaaggaccgtattcttgagctgtatctgaacgaggtgtac
ctcggccagagcggcagcgaccagatccgcggtttcccgctggccagcctgtattacttc
ggccgcccggtggacgaactgagtctggatcagcaagcattgctggtggggatggtgaaa
ggcgcatccttgtataacccgtggcgcaacccgacgttggcgctggagcgccgcaatctg
gtgctcaagctgttgcaaaatcagggggttatcgacgccgaactgtacaatatgctcagc
gcgcggccgctgggcgtgcagccgaaggggggggtgatcacgccgcagccggcgtttatg
cagatggtgcgtcaggaactgcaggccaagttgggcgacaaggtgaacgacctgtccggg
gtgaaaatcttcaccacgctggatccggtatctcaggatgcggcggaaaaagcggtcgaa
gacggtattccggcgctgcgtgccgcccgccatcttaacgatctggaagcggcgatggtg
attgtcgatcgcttcagcggtgaggtgcgtgccatggttggcggtgccaatccgcagttc
gccggttttaaccgcgcgatgcaggcgcgccgcctggtcgggtcgctggccaagccgcca
acctacttgaccgcgctttccgagccggacaaataccgcctgaatacctggctggcggac
cagccgctgtcgctgaaactgccgaatggcagcctgtggcaaccgaacaactacgaccgc
aaattccgtggacaggtaatgttggtggatggcctggccttctcgctcaacgtgccgacg
gtgaatttgggtatggcggtcgggctggatcaaatcagcgctaccttgcaacgtttgggt
attcctaaagcggaaatcaacccggtgccttcgatgctgctgggggcgattggtctgacg
ccgatggaagtggcgcaggaataccaaaccatcgccagcggcggtaaccgcgcgccgttg
tctgcggtgcgttcggtgattgcggaagacggttcggtgctgtaccagagcttcccgcaa
gcggaacgcatggtgccggctcaggccgcttacctgacgctgtacgccatgcagcagggt
gtagcgcgcgggacctcccgttctctgtcggtgaagttccccaactacaacctggcggcg
aagaccggtaccaccaacgatctgcgcgacagctggtttgccggtatcgacggtaaagaa
gtggctatcgcctgggttggccgtgacaacaacggcccggccaagctgaccggcgccaac
ggtgcgctgaccctgtatcgccgctatctggaaaaccagacgccgctgccgctgatgctg
cagccgccggaaggcatcaaccagattggcatcgactccgccggtaactttgtctgtggc
gagggcgggcgcagcatcccggtgtggaccgataatccgcaagggctgtgtcaggcaagc
caggccgctcagcagcagcaacagcagcaacagccggcgggtgagcaaaaagacgctgac
ggcgtcgccggctggatcaaggatatgttcggccagggccagtaa

DBGET integrated database retrieval system