KEGG   Serratia plymuthica S13: M621_22475Help
Entry
M621_22475        CDS       T02716                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sry  Serratia plymuthica S13
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sry00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M621_22475
   00650 Butanoate metabolism
    M621_22475
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M621_22475
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M621_22475
Enzymes [BR:sry01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     M621_22475
Amino acid related enzymes [BR:sry01007]
 Aminotransferase (transaminase)
  Class III
   M621_22475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4779742..4781007)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIERQLKAFTHTAYQIVPYESYVALAERINQRAPIEGPCKTALFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNIAPADFMQALRELCDQHGILLIADEV
QTGFARTGKLFAMEHYAVKPDLITMAKSLAGGMPLSAVAGRADVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIDEEQLCQRSQRLGQHLVEVLQQARKTSPAIADIRAQGSMVAVEFKD
PATGKPSAEITRQVQQKALEEGLLLLSCGVNGNVIRFLYPLTIPEEQFTQALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgccaggatgccaccccacgcgggattggcgtg
atgtgcggtttttacgccgagcgtgcggagaacgccacgctgtgggacgtagaaggcaat
gaggttatcgatttcgcttccggtattgctgtcctgaataccggacaccggcatccgaag
gtgatcgccgccattgaacggcaactgaaggccttcacccacaccgcttaccaaatcgtt
ccttacgaaagctatgtcgcgttggcagagcgcatcaaccagcgcgcaccgattgaaggc
ccttgtaaaaccgccttgttcaccaccggcgcagaagcggtggaaaacgcggtcaaaatc
gcccgtgcctataccggtcggccgggcctgatcacctttggcggcggtttccatggccgc
acttacatgaccatggcgctgaccggcaaagtggcgccgtacaagctgggcttcgggccc
ttccccggttcggtgttccacggccagtatccgaatgcgctgtatggcgtgaccaccgaa
gacgcgatgaacagcctggaacgcatctttaaggcggatatcgatcccaaacaagtggcc
gccatcgtgctggagccggtgcagggcgaaggcggtttcaacatcgcgccggccgatttt
atgcaggcgctgcgcgaactgtgcgaccagcacggcattttgctgattgccgacgaagtg
cagaccggttttgcccgtaccggcaagctgtttgccatggaacattacgcggtgaaaccg
gatctgatcaccatggcgaaaagcctggcgggcggtatgccgctgtcggcggtggccggc
cgtgccgacgtgatggacgccccggcgccgggcgggctgggtggcacctatgccggtaac
ccgctggcggtggctgcggcacttgcggtgctggacgtgatcgacgaagaacagctgtgc
cagcgttctcaacgtttgggccagcatttggtggaagtgctgcaacaggcgcgcaaaacc
agcccggcgatcgcggatattcgcgcgcagggttcaatggtggcggtggagttcaaggat
ccggcgaccggcaagccttcggcggagatcacccgtcaggtacagcagaaggcgctggaa
gagggcctgctgctgttgagctgtggtgtgaacggcaacgtgatccgcttcctgtatccg
ctgaccatccctgaggaacagttcacccaggcgctgggcattctttcccgcgcgttggcc
caataa

DBGET integrated database retrieval system