KEGG   Serratia plymuthica S13: M621_24905Help
Entry
M621_24905        CDS       T02716                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sry  Serratia plymuthica S13
Pathway
sry00620  Pyruvate metabolism
sry00680  Methane metabolism
sry01100  Metabolic pathways
sry01120  Microbial metabolism in diverse environments
sry01200  Carbon metabolism
Module
sry_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sry00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M621_24905
  Energy metabolism
   00680 Methane metabolism
    M621_24905
Enzymes [BR:sry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M621_24905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGP46551
UniProt: S4YPU7
Position
5304637..5307273
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHSISPNGEAASNPEALAQLFTRLKDKKLSTKE
LQNAVSQLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKNRPSPIDEAKWGFAVVENSLWEGVPAFLREFNEQLENSIDYSLPAEAV
PVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKACDLFTRDIQVLVSELSMTECTPELRA
LAGGDEVQEPYREIMKQLRGQLMRSQAYLEGRLKGERVLKPNDLLVSNDQLWEPLFACYQ
SLQACGMSIIANGQLLDTLRRVRCFGVPLVRIDVRQESNRHTEAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMARTPS
DVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVAISSLALYAGAVLEANLLPPPEPKKEWRSLMDDLS
ETSCKMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRKPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQEAVKAGKQNQLEAMCRDWPFFSTRIAMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLESDIKVVLTIANDAHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDTRVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaatgtcagtatgctcggcaaattgctcggc
gataccatcaaagatgcgctgggcgagcatattctcgatcgcgttgaaactatccgtaag
ctttccaaatcttcacgtgccggtaacgaggcgcatcgtcaggagctgctttccaccttg
cagaacctgtccaacgacgagttgctgccggtcgcgcgcgccttcagccagttccttaat
ctgaccaacgtcgccgagcagtaccacagcatttcgcccaatggcgaagccgccagcaat
cccgaagcgctggcccagctgttcacccggctgaaagacaaaaagctcagcaccaaagag
ctgcaaaatgcggtctctcagctctccatcgagctggtgctgacggcgcacccgacggaa
ataacccgccgcaccctgatccacaagctggttgaggtcaacacctgtctgagccaactc
gatcataacgatctggccgattacgagcgcaacaagatcatgcgccgcctgcgccagctg
gttgcccagtcatggcacaccgacgagatccgtaaaaaccgcccttcgcctatcgacgaa
gccaagtggggctttgcggtggtggaaaacagcctgtgggaaggggtgcctgccttcctg
cgcgaattcaacgagcagttggaaaactccatcgattacagcctgccggcggaagccgtg
ccggtgcgtttcacctcctggatgggcggtgaccgcgacggtaacccgaacgtgaccgcc
gaaatcacccgtcacgtgctgctgctcagccgctggaaagcctgcgacctgttcacccgc
gatatccaggtgttggtgtccgagctgtcgatgaccgaatgtactccggaattgcgcgcc
ctcgccggtggcgacgaagtgcaggaaccgtaccgcgaaatcatgaaacagctgcgcggc
cagttgatgcgctctcaggcctatctggaaggccgcctgaaaggcgaacgcgtgctgaaa
ccgaacgacctgctggtaagcaacgatcagctgtgggaaccgttgttcgcctgttatcag
tcgctgcaggcctgcggcatgagcatcattgccaacggtcagttgctggataccctgcgc
cgcgttcgctgctttggcgtgccgctggtgcgtatcgacgtccgtcaggaaagcaaccgc
cataccgaagccatcgccgaactgacccgttatctgggcctcggcgactacgaaagctgg
tcagaagccgacaaacaagcattcctgatccgcgaactgaattccaaacgcccgctggtg
ccgctgaagtgggaaccgagtgccgatacccaggaagtgctggaaacctgccgcgtgatc
gccgaagcgccgcaaggctccatcgccgcctacgtcatctccatggcacgcaccccttct
gacgtgctggcggtccatctgctgctgaaagaagccggttgcccgtttgcgctgccggtc
gcgccgctgttcgaaaccctcgacgacctgaacaacgccgacgacgtgatgacccagttg
ctgaatatcgactggtatcgcggctttatccagggcaagcagatggtgatgatcggctat
tccgactcggcgaaagacgccggggtgatggccgcgtcctgggcgcagtaccgcgcgcaa
gatgccttgatcaaaacctgtgaaaaggccggagtggcgttaacgctgttccacggccgt
ggcggttcgattggtcgcggcggcgcgcctgcgcatgcggcgctgctgtcgcagcctccg
ggcagcctgaaaggtggcctgcgcgtgaccgagcagggtgagatgattcgcttcaaattt
ggcctgccggaagtggccatcagcagcctggcgctgtatgccggcgcggttctggaagcc
aacctgttgccgccgccggagccgaagaaagagtggcgttcgctgatggacgacctgtcg
gagacatcgtgcaaaatgtaccgcggctacgtgcgcgagaatccggacttcgtgccttac
ttccgcgccgcaacgccggagctggaactgggtaaactgccgctgggttcacgcccggcc
aagcgcaagccaaacggcggcgtagaaagcctgcgcgccattccgtggatcttcgcctgg
acgcagaaccgcctgatgctgccggcctggctgggtgccggcgcaggtttgcaggaagcg
gtgaaagccggcaaacagaatcagttggaggccatgtgccgcgactggccgttcttctct
acccgcatcgccatgctggaaatggtcttcgccaaggccgacctgtggctggcggaatac
tacgatcagcgtctggtcgacaaatcgctgtggccgctgggccagcagctgcgcgatcag
ctcgaaagcgacatcaaggtcgtgttgaccatcgccaatgacgctcacctgatggaggat
ctgccgtggatcgccgaatccatcgcgctgcgcaacgtgtataccgatccgctgaacgtg
ctgcaggcagaactgctgcaccgctcgcgccagcaggaacatcctgatacccgcgttgaa
caggcattgatggtcaccattgccggcgtcgccgccggcatgcgcaacaccggctag

DBGET integrated database retrieval system