KEGG   Serratia plymuthica S13: M621_25460Help
Entry
M621_25460        CDS       T02716                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sry  Serratia plymuthica S13
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sry00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M621_25460
Enzymes [BR:sry01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     M621_25460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5422336..5423262)
Genome map
AA seq 308 aa AA seqDB search
METGKLVVLGSINADHILNIEQFPRPGETVIGKQYKVAFGGKGANQAVAAGRSGADIAFI
ACVGADDIGERIRLQLATDRIDTQPIEAIADNTTGVALIFVNAEGENVIGIDAGANAAVT
PDYLARYQQRVIEADALLMQLESPLETVMAAARLAKQHQTQVILNPAPARELPDELLALV
DMITPNETEAQRLTGIAIANDDDAARAAKALHDQGIGTVIITLGSRGVWLSENGNGKLVP
GFKVKAVDTIAAGDTFNGALVTALLEGKTMADAVRFAHAAAAIAVTRPGAQPSVPWREEI
DAFLQQQE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggtaagctggtggtgcttggcagtatcaatgccgaccatatcctcaatatt
gagcagtttccccgcccgggcgaaacggtgatcgggaaacagtataaggtggcatttggc
ggtaaaggcgcgaatcaggcggtggcggccgggcgcagcggtgcagatatcgcttttatc
gcctgcgtcggcgcagatgacatcggtgaacgcatccgcctgcaattggcgaccgatcgc
attgatacccaacctattgaggcgattgccgacaacaccacgggtgtggcgctgattttt
gttaatgcggaaggcgagaacgtgatcggcatcgatgccggcgccaatgccgccgtaacg
cccgactatctggcgcgttatcagcagcgggttattgaagccgatgctttgctgatgcag
ctcgagtcgccgctggaaacggtgatggctgccgcccgtctggcgaagcagcatcaaact
caggtgatcctcaatccggcgccggcgcgtgaactgccggacgagttgctggcgttggtc
gatatgattacgcccaatgaaacagaagcccagcgcctcaccggcatagctatcgctaat
gatgatgacgcggcgcgtgcggcgaaagccttgcacgatcaaggcatcggcacggtgatc
ataactcttggcagccgtggcgtttggttgagtgagaacggtaacggtaagttggtgccc
ggcttcaaggttaaagcggtagacaccatcgctgccggtgataccttcaacggggcgctg
gtgacggcgctactggaaggtaaaactatggcggatgcggtgcgcttcgcccatgcggcg
gcggcgattgcggtaacccgtcccggcgctcagccctccgtaccctggcgtgaagagatc
gacgccttcttgcagcagcaggagtaa

DBGET integrated database retrieval system