KEGG   Streptococcus sanguinis: SSA_0068Help
Entry
SSA_0068          CDS       T00473                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSA_0068 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_0068 (adhE)
   00620 Pyruvate metabolism
    SSA_0068 (adhE)
   00650 Butanoate metabolism
    SSA_0068 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SSA_0068 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSA_0068 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSA_0068 (adhE)
   00626 Naphthalene degradation
    SSA_0068 (adhE)
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSA_0068 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SSA_0068 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70254..72908
Genome map
AA seq 884 aa AA seqDB search
MAEKKKTVEQEDKALAAQKHVDELVQKGLVALEEMRKLNQEQVDYIVAKASVAALDAHGE
LALHAYEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVC
GITPTTNPTSTAIFKALISLKTRNPIIFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQ
WITQPSMEATSALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIR
QAAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVEEFKSYHTYFVNKKEKALLEEFCFG
AKANSKNCAGAKLNPDIVGKPATWIAEQAGFSVPEDTNILAAECKEVGEKEPLTREKLSP
VIAVLKSESREDGIEKARQMVEFHGLGHSAAIHTADEELTKEFGKAVRAIRVICNSPSTF
GGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRRNNMQWMKLPSKTYFE
RDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITT
VERGTEIMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFP
LLGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPG
FVAADTGMDVLTHATEAYVSQMASDFTDGLALQAIKLVFENLESSVKNADFHSREKMHNA
STIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYN
YYRADEKYQDIARMLGLPASTPEEGVESFAKAVYELGERVGIEMNFKAQGIDEKEWKEHS
RELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagaagaaaacggtagaacaagaagacaaggctttggcagcgcaaaagcat
gtcgacgaattggtgcaaaaaggtctggttgcactcgaggaaatgagaaagctgaatcag
gaacaggtggattacattgtagccaaggcttctgtagcagctttggatgcccatggtgag
ttggctctgcacgcttatgaagaaacgggccgtggagtttttgaagataaggcgactaaa
aaccttttcgcctgtgagcacgttgtgaataatatgcgccatacgaaaactgtcggtgtt
attgaagaagatgatgtgactggattgaccttgattgcggagccagtgggtgttgtctgc
ggtatcacaccgactactaacccaacttcaacagctatttttaaggctttgatttcctta
aaaacacgtaatccgattatctttgctttccacccatcagctcaagaatcatctgcccat
gcagcgcaaatcgttcgtgatgcagcgattgcagcaggtgcgcctgagaactgtgtgcaa
tggattacacaaccatctatggaagcaacttctgcccttatgaaccatgaagggattgca
acaatccttgcgacaggtggtaacgcaatggtgaaggcagcttactcatgtggtaagcca
gctctgggggttggtgccggaaacgtaccagcttatgtggaaaaatccgctaatatccgt
caagcagcgcacgatatcgttatgtctaaatcctttgacaatggtatggtctgtgcttct
gagcaagccgttatcattgacaaggaagtttatgatgaatttgtagaagagttcaaatct
tatcatacttactttgtaaataagaaagaaaaagctctgttggaagaattctgcttcggt
gctaaggcaaacagcaagaactgtgctggtgctaagctcaatccggatatcgttggtaag
ccagctacttggattgcagagcaggcaggcttcagcgtgccagaagacacgaatatcttg
gccgcagagtgtaaagaagttggtgaaaaggagccattgacacgtgaaaaactgtcacct
gtcatcgctgtgctcaagtctgaatcccgtgaagacggtattgaaaaggcccgtcaaatg
gtagaattccatggtcttggtcactcagctgctatccatacagcggacgaagaattgact
aaggaatttggtaaggctgttcgtgccatccgtgttatttgcaactcaccttctactttc
ggcggtatcggggatgtttataatgccttcctgccatcactgactttgggctgtggatct
tatggtcgcaactcagtaggtgataacgttagtgctgtgaatctcttgaacatcaaaaaa
gtaggaagacgtagaaataatatgcaatggatgaaactcccttcaaaaacttacttcgag
cgtgactctatccaatacctgcaaaaatgtcgtgatgtggaacgtgtcatgatcgtaaca
gaccatgctatggtagagcttggtttcctagatcgtatcatcgaacaactcgatcttcgt
cgtaataaggttgtttaccaaatctttgcagacgtagaaccagatccagatatcacaact
gttgaacgtggtacagagattatgcgtaccttcaaacctgatacaatcatcgcgcttggt
ggtggttcaccaatggacgcagctaaagtaatgtggctcttctatgagcaaccagaagtg
gacttccgtgaccttgtgcaaaaattcatggatatccgtaaacgtgccttcaaattcccg
ttgcttggtaagaagactaagtttatcgcaatccctacaacatctggtacaggttcagaa
gtgacaccatttgccgttatctctgacaaggctaataaccgtaagtacccaatcgctgat
tactctctgactccaactgtggccatcgtagacccagctctggtactgactgttccagga
tttgtcgcagcagacactggtatggacgtgctgacgcacgcaacagaagcttatgtatct
cagatggccagcgactttactgatggtttggctctccaagctatcaaactagtctttgaa
aatctggaaagctctgttaagaacgctgacttccactctcgcgaaaagatgcacaatgcc
tctactatcgctggtatggcctttgccaatgccttcttgggaatttcccattctatggcc
cataagattggtgctcagttccatactatccacggtcgtacaaatgctatcttgttgccg
tacgtaatccgctacaacggtacacgtccagctaagacagcgacatggcctaagtacaac
tactaccgtgcggatgagaaataccaagacatcgctcgtatgcttggcttgccagcttct
actccagaagaaggtgttgaatcatttgcgaaagctgtttatgaactgggagaacgtgtc
ggtatcgaaatgaacttcaaggctcaaggtattgacgaaaaagaatggaaagaacattca
cgcgaattggccttccttgcctatgaagaccaatgttctccagccaacccacgccttcca
atggttgaccacatgcaggaaatcatcgaagacgcatactatggctacaaggaacgccca
ggacgccgcaaataa

DBGET integrated database retrieval system