KEGG   Streptococcus sanguinis: SSA_0095Help
Entry
SSA_0095          CDS       T00473                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00260  Glycine, serine and threonine metabolism
ssa00750  Vitamin B6 metabolism
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01120  Microbial metabolism in diverse environments
ssa01230  Biosynthesis of amino acids
Module
ssa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSA_0095 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSA_0095 (thrC)
Enzymes [BR:ssa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSA_0095 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 4806923
NCBI-ProteinID: YP_001034107
UniProt: A3CK52
Position
96695..98179
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDEKNRVTASQAILQGLATDGGLFTPITYPQVDLDFAKLKDASYQEVAKLVL
SAFLDDFSEAELDYCINHAYDSKFDDAAIAPLVKLDGQYNLELFHGATIAFKDMALSILP
HLMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKRMFNDTDLRARLLEHKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKAGEIIAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNENNVLTD
FFKTHIYDKKRSFKVTSSPSMDILVSSNLERLIFHLSGNSAEKTAALMAALNEHGQYELT
DFDAEILELFAADYATEQETAAEIKRVYQASDYIEDPHTAVASAVYQKYLAETGDQRKTV
IASTASPYKFPVVAVEAVTGQTGLSDFEALDQLHELSGVALPPAVDGLETAPVRHKTTVA
ADQMQTAVEDYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagtttatcaatcaacacgcgacgaaaagaatagagtaacagccagccaggcg
attctgcaaggcttggcgacagacggcggtctctttacgcccattacctatccgcaggtc
gatttggactttgccaagctcaaagatgcttcttatcaggaagtagccaagctggttttg
tccgcatttttggatgatttttctgaagcagagctggactactgtatcaaccatgcctac
gacagcaagtttgatgatgcggctattgctcccttggtcaagctggatggtcagtacaat
ctagaacttttccacggagcgaccattgccttcaaggatatggctttgtctatcctgcct
catctgatgacaaccgcagctaaaaagcacggtttggaaaacaaaattgtcattttgacg
gcgacttctggcgacacaggcaaggcggctatggcaggctttgcggacgttcctgggact
gagatcattgtcttttatccgaaagatggtgtcagcaaggttcaagagttgcaaatgacg
acccagacaggtgccaatacgcatgttgttgccattgatggcaactttgacgatgcccag
accaatgtcaagcgcatgtttaacgacacagacctacgagctcgtctcttggagcacaaa
ctccagttttcatctgctaattccatgaatatcggccgtttggtgccgcagattgtctac
tatgtctatgcttatgctcagctggtgaaggcgggagaaatcatagcaggagacaaggtc
aactttaccgttccgacagggaactttggtaatatcttggcggcctactatgccaagcaa
atcggtctgccagttggcaagctgatctgtgcatcgaatgaaaacaatgtcctgacggac
ttcttcaagacccacatctatgacaagaagcggagcttcaaggtgacatctagtccatcc
atggatattttggtttcctctaacttggagcgtttgattttccacctgtctggtaacagc
gctgagaaaacagctgctttgatggcggctttgaatgagcatggacagtatgaactgacg
gactttgacgctgagattttagagctctttgcggctgattatgcgacagagcaagaaaca
gctgctgaaatcaagcgggtctatcaagcatctgactacatcgaagaccctcatactgcc
gttgcatctgctgtctatcaaaaatatctggcagagacaggtgatcagcgcaagactgtt
atcgcgtctaccgctagtccttataaattcccagtcgtggctgttgaggctgtgaccggc
cagacaggacttagtgactttgaggctttggaccaactgcacgaactttctggcgtagcc
cttccaccagctgtggatggcttagaaacagcaccggttcgccacaaaacgacggtcgct
gcagaccaaatgcagacagcagtcgaggattatttgggattgtaa

DBGET integrated database retrieval system