KEGG   Streptococcus sanguinis: SSA_0095Help
Entry
SSA_0095          CDS       T00473                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSA_0095 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSA_0095 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSA_0095 (thrC)
Enzymes [BR:ssa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSA_0095 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
96695..98179
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDEKNRVTASQAILQGLATDGGLFTPITYPQVDLDFAKLKDASYQEVAKLVL
SAFLDDFSEAELDYCINHAYDSKFDDAAIAPLVKLDGQYNLELFHGATIAFKDMALSILP
HLMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKRMFNDTDLRARLLEHKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKAGEIIAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNENNVLTD
FFKTHIYDKKRSFKVTSSPSMDILVSSNLERLIFHLSGNSAEKTAALMAALNEHGQYELT
DFDAEILELFAADYATEQETAAEIKRVYQASDYIEDPHTAVASAVYQKYLAETGDQRKTV
IASTASPYKFPVVAVEAVTGQTGLSDFEALDQLHELSGVALPPAVDGLETAPVRHKTTVA
ADQMQTAVEDYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagtttatcaatcaacacgcgacgaaaagaatagagtaacagccagccaggcg
attctgcaaggcttggcgacagacggcggtctctttacgcccattacctatccgcaggtc
gatttggactttgccaagctcaaagatgcttcttatcaggaagtagccaagctggttttg
tccgcatttttggatgatttttctgaagcagagctggactactgtatcaaccatgcctac
gacagcaagtttgatgatgcggctattgctcccttggtcaagctggatggtcagtacaat
ctagaacttttccacggagcgaccattgccttcaaggatatggctttgtctatcctgcct
catctgatgacaaccgcagctaaaaagcacggtttggaaaacaaaattgtcattttgacg
gcgacttctggcgacacaggcaaggcggctatggcaggctttgcggacgttcctgggact
gagatcattgtcttttatccgaaagatggtgtcagcaaggttcaagagttgcaaatgacg
acccagacaggtgccaatacgcatgttgttgccattgatggcaactttgacgatgcccag
accaatgtcaagcgcatgtttaacgacacagacctacgagctcgtctcttggagcacaaa
ctccagttttcatctgctaattccatgaatatcggccgtttggtgccgcagattgtctac
tatgtctatgcttatgctcagctggtgaaggcgggagaaatcatagcaggagacaaggtc
aactttaccgttccgacagggaactttggtaatatcttggcggcctactatgccaagcaa
atcggtctgccagttggcaagctgatctgtgcatcgaatgaaaacaatgtcctgacggac
ttcttcaagacccacatctatgacaagaagcggagcttcaaggtgacatctagtccatcc
atggatattttggtttcctctaacttggagcgtttgattttccacctgtctggtaacagc
gctgagaaaacagctgctttgatggcggctttgaatgagcatggacagtatgaactgacg
gactttgacgctgagattttagagctctttgcggctgattatgcgacagagcaagaaaca
gctgctgaaatcaagcgggtctatcaagcatctgactacatcgaagaccctcatactgcc
gttgcatctgctgtctatcaaaaatatctggcagagacaggtgatcagcgcaagactgtt
atcgcgtctaccgctagtccttataaattcccagtcgtggctgttgaggctgtgaccggc
cagacaggacttagtgactttgaggctttggaccaactgcacgaactttctggcgtagcc
cttccaccagctgtggatggcttagaaacagcaccggttcgccacaaaacgacggtcgct
gcagaccaaatgcagacagcagtcgaggattatttgggattgtaa

DBGET integrated database retrieval system