KEGG   Streptococcus sanguinis: SSA_0199Help
Entry
SSA_0199          CDS       T00473                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ssa  Streptococcus sanguinis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
198416..198970
Genome map
AA seq 184 aa AA seqDB search
MDTKKIEAAVAQIIEAVGEDGSREGLQETPQRIAKMYQEIFAGLGETAEEHLAKSFEIID
NNMVVEKDIFFHSMCEHHFLPFYGKVHIAYVPNGRVAGLSKLARTVEVYAKKPQIQERLT
VEIAEALMDYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGVLATDKDLKNEAYK
LMGH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaagaaaattgaagcagctgtagcccagattattgaggcggttggagaagac
ggaagccgcgaaggattgcaggagacgccacagcgcattgctaaaatgtaccaggaaatc
tttgcggggctgggtgagacggctgaggagcatctggccaagtcttttgaaatcattgac
aataatatggtagtggagaaggatattttctttcattccatgtgtgagcatcacttcctg
ccattttacgggaaggttcatatcgcctatgtgcctaatggtcgggtagcaggcctgtcc
aagctggctcggacggtagaggtctatgccaagaaaccgcagattcaagagcgattgacc
gtagagattgctgaggccttgatggactatctgggtgctcaaggggccttagtctgggta
gaagctgagcatatgtgtatgaatatgcgcggagtcagaaagcctggcactgcaacagtt
actacagcggcgcgtggcgttttagcgacggataaggacctaaaaaatgaagcttacaaa
ttgatggggcattga

DBGET integrated database retrieval system