KEGG   Streptococcus sanguinis: SSA_0200Help
Entry
SSA_0200          CDS       T00473                                 

Gene name
folK
Definition
bifunctional folate synthesis protein (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
ssa  Streptococcus sanguinis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199058..199870
Genome map
AA seq 270 aa AA seqDB search
MDQLRIKDLEVYAYHGLFGAEKELGQRFVLDLILDYDMTRAAKTGDLTASIHYGELAQDL
TYWCQESKEDLIETLAYKLIDRIFLTHPLVQKVSLEVKKPWAPVPLPLETCSVKLVRQKR
KAFIALGSNQGSPTANLDAALEKMAEQNIRVLQASSRIETEPWGGVEQDPFLNQVVEVET
WLNPEELMQTLLAIESDLGRVREIKWGPRVIDLDILYIGQEELYSPNLIVPHPYVAERAF
VLQSLVEIAPHFVDPVQKKSIRQLWDAVEK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcagctgcgcattaaggatttggaagtgtatgcctatcacggtctgtttggagca
gagaaggaattgggccagcgttttgtgctggatctgattttggactatgatatgactcgg
gctgccaaaacaggcgacctgacagcttctatccactatggagaattggctcaggatttg
acctactggtgtcaggaaagcaaggaagacttgattgaaacgctggcttacaagctgatt
gatcggatttttctgactcatcctttggtgcagaaggtcagcttggaggtcaagaagcct
tgggcacccgtgccgctgcctttagagacctgctcagtcaagctggtgcgtcaaaagcgg
aaagcctttatcgctctggggagcaatcaaggcagcccaactgccaatctggatgcggct
ctggaaaaaatggcagagcaaaatataagagttttgcaggcatcaagccgcattgagaca
gagccttggggtggcgttgagcaggatccgtttctcaatcaagttgttgaagttgagact
tggctcaatcctgaggagttaatgcagacgctcttggctatcgaatcggatctagggcgc
gtgcgggaaatcaaatggggacctcgtgtgattgatttggatattctttacataggacaa
gaagagttatacagtccaaacttgattgttcctcatccttatgtggctgagcgagctttt
gtcttgcaatctctggtggaaatcgccccacactttgtcgatcccgtgcagaaaaaaagc
attcgccagctctgggatgcggttgaaaaatga

DBGET integrated database retrieval system