KEGG   Streptococcus sanguinis: SSA_0271Help
Entry
SSA_0271          CDS       T00473                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ssa  Streptococcus sanguinis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssa00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ssa00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ssa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
264375..266153
Genome map
AA seq 592 aa AA seqDB search
MAKFEIKEEFYLDGKPFKILSGAIQYFRLHPDQWRDTLYNLKALGFNTVETYIPWALHEP
QEGQFKAEGMLDFEAYFKLVKEMGLYLIVRPTPYICAEFDFGGLPAWLLRYPSMRLRVNH
PLFLEKVSHFYDWLFPKLLPYQSDQGGPILMMQVENEYGSYAEDKAYMRSIAQMMKVRGV
TVPLFTSDGTWIEALESGTLIEDDIFVTGNFGSQPKENTDNLRAFMERYGKKWPLMCTEF
WDGWFSRWSEEIVRREAEDLAQDVKEMLQLGSMNLFLLRGGTNFGFISGCSARKTKDLPQ
ITSYDFDAPITEWGQPTEKYYAVQRVTHEVFPELEQMEPISRQAKAYGSFPLLGTANLLD
VAADITEEILLDYPQPMEQIGQNYGYILYRSDIKNQYHEERLKALETHDRCHFYVNQEHL
TTQYREEIGDEMLFSADTERIQIDVLVENMGRVNYGYKLGAPSQSKGVKGGIMINHQFRK
GWKHYALKFDQEMLAKLDCYSDPPEKVKAPTFYRFEAELDDIADTFIDCSKYGKGCISVN
GFNLGRYWNEGPIHYLYVPSSLLKEKNEFIVFETENVKIEELTLLDHPVYKK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaaattaaagaagaattttacttggatggcaagccttttaagatttta
tcgggagctatccagtatttccggctccatccagaccagtggcgagataccctttacaat
cttaaagctttaggctttaatacggtagaaacttatattccttgggcattgcatgagcct
caggaaggtcagtttaaggcagagggcatgctggattttgaagcatacttcaagttggtt
aaggagatggggctttatctcattgtccgtccgacaccttacatctgtgcagagtttgac
tttggcggcctgccggcttggctcttgagatatccttcgatgcgcctgcgggtcaatcat
ccgctttttctggaaaaggtcagtcatttttatgactggctctttcccaagcttctgccc
tatcagagtgatcaaggcggtcctatcctcatgatgcaggtggaaaatgaatacgggtct
tatgccgaggacaaggcctacatgcgcagcattgcacagatgatgaaggtacgtggcgtt
acggttcccctctttacctctgacgggacatggatagaggctttggagtctggaactttg
attgaggatgatatttttgtgacggggaattttggctcccaacccaaagaaaatacagac
aatctacgagctttcatggagcgctatggcaagaaatggcctcttatgtgtactgagttt
tgggacggctggttcagccgctggagcgaggaaatcgttcggcgagaggcagaagatttg
gcccaggatgtcaaagaaatgctgcagctgggcagcatgaaccttttcctattgagaggt
gggaccaattttggttttatcagcggctgttcagcccgcaagacaaaggatttgccacag
attacctcctatgattttgacgcacccattactgagtgggggcagccaaccgagaaatac
tacgctgttcagcgggtgacacacgaggtctttccagagcttgagcagatggagccgatt
agccgacaggccaaggcctatggcagttttccgctgcttgggactgcaaatttgctggat
gttgcagcggacatcacagaggaaattctgctggattatccgcagcctatggagcagatt
gggcagaattatggctatatcctctaccgttccgatatcaaaaatcaataccatgaggaa
aggctcaaggccttggagactcatgaccgctgccatttctatgtcaatcaggagcaccta
actacccagtatcgggaagaaatcggtgatgagatgctcttctcagctgacaccgagcga
attcagattgatgtgctggtggaaaatatggggcgtgtaaactatggttacaagctgggc
gcacctagtcaatccaagggagtcaaggggggtatcatgattaaccaccagttccgcaag
ggctggaagcattatgcgcttaagtttgaccaggaaatgctggccaagttagactgctac
tcagatccaccggaaaaagtcaaagcaccgaccttctatcgctttgaagcagagttggat
gatatcgctgataccttcatcgactgctctaagtatgggaagggctgtatttcggtcaac
ggcttcaacctaggccgctactggaatgaagggccgattcactatctctatgtgccgtct
agcctgcttaaggaaaagaatgaatttatcgtctttgaaactgaaaatgtcaagattgaa
gagttgaccttgcttgaccatccagtctataagaaatga

DBGET integrated database retrieval system