KEGG   Streptococcus sanguinis: SSA_0271Help
Entry
SSA_0271          CDS       T00473                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ssa  Streptococcus sanguinis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSA_0271
  Lipid metabolism
   00600 Sphingolipid metabolism
    SSA_0271
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SSA_0271
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SSA_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
264375..266153
Genome map
AA seq 592 aa AA seqDB search
MAKFEIKEEFYLDGKPFKILSGAIQYFRLHPDQWRDTLYNLKALGFNTVETYIPWALHEP
QEGQFKAEGMLDFEAYFKLVKEMGLYLIVRPTPYICAEFDFGGLPAWLLRYPSMRLRVNH
PLFLEKVSHFYDWLFPKLLPYQSDQGGPILMMQVENEYGSYAEDKAYMRSIAQMMKVRGV
TVPLFTSDGTWIEALESGTLIEDDIFVTGNFGSQPKENTDNLRAFMERYGKKWPLMCTEF
WDGWFSRWSEEIVRREAEDLAQDVKEMLQLGSMNLFLLRGGTNFGFISGCSARKTKDLPQ
ITSYDFDAPITEWGQPTEKYYAVQRVTHEVFPELEQMEPISRQAKAYGSFPLLGTANLLD
VAADITEEILLDYPQPMEQIGQNYGYILYRSDIKNQYHEERLKALETHDRCHFYVNQEHL
TTQYREEIGDEMLFSADTERIQIDVLVENMGRVNYGYKLGAPSQSKGVKGGIMINHQFRK
GWKHYALKFDQEMLAKLDCYSDPPEKVKAPTFYRFEAELDDIADTFIDCSKYGKGCISVN
GFNLGRYWNEGPIHYLYVPSSLLKEKNEFIVFETENVKIEELTLLDHPVYKK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaaattaaagaagaattttacttggatggcaagccttttaagatttta
tcgggagctatccagtatttccggctccatccagaccagtggcgagataccctttacaat
cttaaagctttaggctttaatacggtagaaacttatattccttgggcattgcatgagcct
caggaaggtcagtttaaggcagagggcatgctggattttgaagcatacttcaagttggtt
aaggagatggggctttatctcattgtccgtccgacaccttacatctgtgcagagtttgac
tttggcggcctgccggcttggctcttgagatatccttcgatgcgcctgcgggtcaatcat
ccgctttttctggaaaaggtcagtcatttttatgactggctctttcccaagcttctgccc
tatcagagtgatcaaggcggtcctatcctcatgatgcaggtggaaaatgaatacgggtct
tatgccgaggacaaggcctacatgcgcagcattgcacagatgatgaaggtacgtggcgtt
acggttcccctctttacctctgacgggacatggatagaggctttggagtctggaactttg
attgaggatgatatttttgtgacggggaattttggctcccaacccaaagaaaatacagac
aatctacgagctttcatggagcgctatggcaagaaatggcctcttatgtgtactgagttt
tgggacggctggttcagccgctggagcgaggaaatcgttcggcgagaggcagaagatttg
gcccaggatgtcaaagaaatgctgcagctgggcagcatgaaccttttcctattgagaggt
gggaccaattttggttttatcagcggctgttcagcccgcaagacaaaggatttgccacag
attacctcctatgattttgacgcacccattactgagtgggggcagccaaccgagaaatac
tacgctgttcagcgggtgacacacgaggtctttccagagcttgagcagatggagccgatt
agccgacaggccaaggcctatggcagttttccgctgcttgggactgcaaatttgctggat
gttgcagcggacatcacagaggaaattctgctggattatccgcagcctatggagcagatt
gggcagaattatggctatatcctctaccgttccgatatcaaaaatcaataccatgaggaa
aggctcaaggccttggagactcatgaccgctgccatttctatgtcaatcaggagcaccta
actacccagtatcgggaagaaatcggtgatgagatgctcttctcagctgacaccgagcga
attcagattgatgtgctggtggaaaatatggggcgtgtaaactatggttacaagctgggc
gcacctagtcaatccaagggagtcaaggggggtatcatgattaaccaccagttccgcaag
ggctggaagcattatgcgcttaagtttgaccaggaaatgctggccaagttagactgctac
tcagatccaccggaaaaagtcaaagcaccgaccttctatcgctttgaagcagagttggat
gatatcgctgataccttcatcgactgctctaagtatgggaagggctgtatttcggtcaac
ggcttcaacctaggccgctactggaatgaagggccgattcactatctctatgtgccgtct
agcctgcttaaggaaaagaatgaatttatcgtctttgaaactgaaaatgtcaagattgaa
gagttgaccttgcttgaccatccagtctataagaaatga

DBGET integrated database retrieval system