KEGG   Streptococcus sanguinis: SSA_0314Help
Entry
SSA_0314          CDS       T00473                                 

Gene name
wcaG
Definition
nucleoside-diphosphate-sugar epimerase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ssa  Streptococcus sanguinis
Brite
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     SSA_0314 (wcaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309057..310109)
Genome map
AA seq 350 aa AA seqDB search
MTPNPTNQKPARTMTHAFVTGATGLLGNNLVRALLKENIQVTALVRSEEKARKQFADLPI
QIVKGDILEPESYRDYLAGCDSLFHTAAFFRDNYKGGKHWQELYDTNIIGTNNLLEAAYE
AGIRQFVHTSSCVVLEGEANQLIDESMSRSKDTPFDYYRSKILSEEAVRDFLDKHSDVFG
CFILPSVMLGPRDLGPTSSGQMIINFVEQKLPGILKASYNMVDARDVADIHLRAMKYGRS
KERYLAVGRQVTMTELYQILEKITGVPAPKRKISPLFVKIYAQASELYHRLTKKPILVTN
ELAHLMAEEYLKSNFSFAKTESELGGQHRPLEESLADVVDWYRKHGYFAK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaaccctacaaatcaaaaaccagctagaacaatgacccacgcttttgtgact
ggtgcgaccggtcttttaggaaataatctcgtgcgtgctctgctaaaagaaaacattcaa
gtgaccgctctcgttcgctccgaggaaaaagcgcgcaaacaatttgccgacctgcctatc
cagattgtcaagggggatattttagagcccgaaagctatcgtgactatctagcaggctgc
gacagcctctttcataccgctgcttttttccgcgataattataaaggcggcaagcactgg
caggagctctacgacactaatattataggcacaaataacctcctagaagctgcttacgag
gctggtatccgccaatttgtccatacttcctcctgtgtcgtactggaaggtgaggccaat
cagctaatcgatgaaagcatgtctcgctcaaaagatactccttttgattactatcgcagc
aagattttgagtgaagaggccgttcgtgatttcttggacaagcattcagatgttttcggt
tgctttatcttgccgagtgtaatgttgggtcctagagaccttggtccgacctccagtggg
cagatgattatcaattttgtagagcaaaaacttccaggtatcttaaaggctagctataat
atggtggatgctagagatgtagcagatattcatctccgcgccatgaaatacggacgctca
aaggagcgctatctggcagttggacggcaagtgaccatgactgaattgtaccaaatactg
gaaaaaatcactggcgttcccgcccccaagcgcaagatctcccctcttttcgtcaaaatc
tatgcccaagcaagtgagctctaccaccggctcaccaaaaaaccaattttggttaccaat
gagctcgctcatctcatggccgaagaatatctcaaaagtaattttagctttgccaaaacc
gagagcgagctaggcggacagcatcgccctctcgaagaaagcttagctgacgtggtagat
tggtaccgcaagcacggctatttcgccaaataa

DBGET integrated database retrieval system