KEGG   Streptococcus sanguinis: SSA_0350Help
Entry
SSA_0350          CDS       T00473                                 

Gene name
recD
Definition
helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssa  Streptococcus sanguinis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSA_0350 (recD)
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SSA_0350 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(341942..344308)
Genome map
AA seq 788 aa AA seqDB search
MEFYFSGTIERIIFENPSNFFRILLLDIEDTDAEDFEDFEIIVTGSMADVMEGEDYSFWG
SLVQHPKYGQQLKISRYERAKPSSKGLVKYFSSDHFKGIGVKTAQKIVQLYGEDTEDTID
KILAEPEKLTQINGLSAKNREAFVAKLRLNYGTEMVLTKLAAYGIPNKLAFQIQDTYKEE
TLDIVEKYPYQLVEDIQGIGFKIADRLAEELGIQSDAPERFRAGLVHTLLTQSMERGDTY
VEARDLLEHTIELLESSRQVELNPSLVADELAHLIEEDKVQNVETKIFENSLFFAEEGIK
SNLVRLLEKGEQDCFDADNITAAIQQVEENSGISYDSIQKEAIRQAINQKVFILTGGPGT
GKTTVINCIIAVYAQLRGLDLRKVNDLPILLAAPTGRAARRMNELTGLPSATIHRHLGMT
GDDDTSHLDDYLDADFIIVDEFSMVDTWLANQLLSNISSQTKLLIVGDADQLPSVSPGQV
LADLLQIPTIPQTKLETIYRQSEESTIVTLASQIQKGILPADFTEKKADRSYFEARNEHI
PPMIEKIASAAIRSGIPAQDVQVLAPMYRGPAGIDQINNLMQNLINPVEKDELTFEAPDC
QYRQGDRVIHLVNDAESNVFNGDLGYISDLLPAKYTDSKQDELTIDFDGNELVYQRSEWY
KIRLAYAMSIHKSQGSEFPVVILPITKSSHRMLQRNLIYTAITRAKSKLILLGEKAAFDY
AAKNTGTARKTYLRERFEDLKSPPELAHTPVDRLEKAVENYVLTEENFLKIDPLIGLTEE
DIHSIFST
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaattttacttttcaggaacgattgaacgtattatttttgaaaatcccagcaacttt
ttccgtatcctactcttagatattgaggatacagatgccgaggattttgaagattttgaa
atcattgtcaccggctctatggcagatgtcatggaaggcgaagactacagcttctggggc
agtcttgtccagcaccccaaatatggccagcaacttaaaatttctcgctatgagcgagca
aaacccagcagtaaaggcctagtaaaatacttctctagtgaccatttcaagggcattggg
gtcaagactgctcaaaaaatcgtccaactctacggagaagataccgaggacaccattgac
aagattttagcagagccagaaaaactgactcagataaacggcttatcagctaagaaccgc
gaggcctttgtcgccaagctcagactcaactacggaacggagatggtactaaccaaactg
gcggcctacggcattcccaataagctggcttttcaaatccaggatacctacaaggaagaa
acgctggatattgtcgaaaaatatccctatcagctggtagaggatattcaggggattggc
tttaaaatcgctgaccgcttggcagaagaactgggcatccaaagtgatgcccctgagcgt
tttcgggctggccttgtccacaccttgctgacccagtctatggagcggggagatacctat
gttgaagctcgtgatttactagagcataccatcgagctcttagaaagctcacgtcaagtg
gagctgaaccctagtctagtcgctgatgagctggctcatctgattgaggaagataaggtc
cagaatgtagaaaccaagatttttgaaaacagcctattttttgctgaggaagggattaag
agtaatctggtccgtctgttggaaaaaggagagcaagactgctttgacgcagataacatt
actgcggctatccagcaagtggaggagaactccggcatctcctatgacagtatccaaaaa
gaagccatccgtcaggctatcaatcagaaggtctttatcctaaccggcggaccgggtact
ggaaaaactacggttatcaactgtatcatcgcagtctatgcccagcttcgcggtttggat
ctgcgaaaggtcaatgatctgcctattctgctagcggctcccactggacgtgctgctcgt
cgcatgaacgaattaactggtcttcctagcgctactattcaccgccatctggggatgact
ggcgatgatgataccagccacttggacgattatctggatgctgattttatcatcgtggac
gaattctccatggtcgatacctggctggctaatcaactgctcagcaatatctcctctcag
accaagctcttgattgtcggagatgcggaccagctgccctctgtcagtccaggtcaggta
ctggcggacttgctgcagataccaactatcccacagaccaagttggaaaccatctatcgg
cagagcgaggagtctacaattgtcacactggccagccagattcagaagggcattttacca
gcagactttacagagaaaaaagcggatcgctcttattttgaagctagaaatgagcatatc
ccgcctatgattgagaaaatcgctagcgcagccattcgcagcggtatcccagctcaagat
gttcaagtattggcacctatgtatcgggggccagccggcattgaccagattaataatctt
atgcaaaatctcatcaatcctgtcgagaaagatgaactgacctttgaagctcccgactgt
cagtatcgccaaggagacagggttattcacttggtcaatgatgctgaaagcaatgtcttt
aacggtgacttaggatatatcagcgacctgctgcctgctaagtacaccgactccaagcag
gacgagctgaccattgactttgatggcaatgaacttgtttatcagcgtagcgagtggtac
aagattcgcctggcctacgccatgagtatccacaagtctcagggcagtgaatttcccgtg
gtcatcttgcccatcaccaagagcagtcatcggatgctgcagcgcaacctcatctacacc
gctatcacccgcgccaagagcaagttgatcttacttggggaaaaagcagcctttgactat
gctgcaaaaaacactggcaccgcccgcaaaacctatctgagagagcgttttgaagacctt
aagtcccctccagaacttgcccacactcctgtggataggttggaaaaagctgtggaaaac
tatgtcctgactgaggaaaatttcctgaaaatcgaccccctaatcggcctgaccgaggaa
gatatccacagtatattcagcacataa

DBGET integrated database retrieval system