KEGG   Streptococcus sanguinis: SSA_0395Help
Entry
SSA_0395          CDS       T00473                                 

Gene name
arb
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
391201..392640
Genome map
AA seq 479 aa AA seqDB search
MTEKLTFPDGFLWGGATAANQCEGAYDADGRGLANVDVVPIGEDRLAIITGKKKMFDFEE
GYFYPAKEAIDMYHRFKEDIALFGEMGFKTYRLSIAWSRIFPKGDELEPNEAGLKFYEDL
FKECHKYGIEPLVTITHFDCPMHLIEQYGGWRNRLMLEFYERLCRTLFTRYKGLVKYWLT
FNEINMILHAPFMGAGLCFEEGENEEQVKYQAAHHELVASAIATKLAHEIDPENKVGCML
AAGQNYPNTCHPRDVWAGMEEDRKNYFFIDVQARGEYPNYAKKAWEREGITVDMTEEDLQ
LLKEHTVDFISFSYYSSRVASGDPKVNELTEGNIFASLKNPYLESSDWGWQIDPLGLRIT
LNTIWDRYQKPMFIVENGLGAVDTPDENGYVADDYRIDYLAAHVKAMREAINEDGVVLWG
YTTWGCIDLVSAGTGEMKKRYGFIYVDRDNEGKGTLKRSKKKSFDWYKEVIATNGASVK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaactgacttttccggatggttttttgtggggtggagcgacagctgccaac
caatgcgagggcgcttacgatgcggatggtcgcgggctggccaatgtagacgtggtgccg
attggtgaggaccgtctggccatcatcacgggtaagaaaaagatgtttgactttgaggaa
ggctatttctacccagccaaggaagctattgatatgtatcatcgctttaaggaggacatt
gccctctttggcgagatgggttttaagacctatcgtctgtccattgcttggagccggatt
ttccctaagggggatgagctggagcccaatgaagctggcctgaaattttacgaagacctc
tttaaggaatgccataagtacggcattgagcccttggtgactattactcactttgactgt
cccatgcacttgattgagcaatatggtggttggcgaaaccgtctcatgctagaattttac
gaacgtctctgccggactctctttacccgttacaagggcttggtcaagtactggctgacc
ttcaatgaaattaatatgatcctccatgcaccatttatgggggcggggctctgctttgaa
gaaggcgaaaatgaagagcaggtcaaataccaagcggcccatcatgagctggtcgcgtca
gccattgctaccaagctggctcatgagattgatccagaaaataaggtcggctgtatgctg
gcggcgggtcaaaattatcctaacacctgtcatccacgcgatgtatgggctggtatggag
gaagacagaaaaaactatttcttcatcgacgtgcaggcgcgtggtgaatatcctaactat
gccaagaaagcttgggagcgcgagggcatcactgtcgacatgacagaagaagacctgcag
ctactcaaggagcatacggtggacttcatttccttctcatactactctagccgggtggct
tcgggagatcctaaggttaatgagctgaccgagggcaatatctttgcttctctcaaaaac
ccttatttggaaagctctgattggggctggcagattgatcctctgggcttgcgcattacg
cttaataccatctgggatcgttatcaaaagcccatgtttatcgtagaaaatggtctgggt
gcagtggatactccggatgaaaatggctatgtggctgatgattaccggattgactatctg
gcagctcatgtcaaggccatgcgggaagccatcaatgaagatggggtagtgctttggggc
tacacgacctggggctgtatcgacctagtatcagccggcactggcgagatgaagaagcgc
tatggctttatctacgtggaccgggacaatgaaggcaagggaacgctcaaacgctccaag
aagaaatcctttgactggtacaaggaagtcatcgcgactaacggagcatctgtgaaatag

DBGET integrated database retrieval system