KEGG   Streptococcus sanguinis: SSA_0419Help
Entry
SSA_0419          CDS       T00473                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssa  Streptococcus sanguinis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSA_0419
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSA_0419
   00600 Sphingolipid metabolism
    SSA_0419
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SSA_0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
416353..418590
Genome map
AA seq 745 aa AA seqDB search
MNKASIWFKEECRQFHLTNGEISYIFRVYEDGKLLQLYYGAVVPERDYSYLVELQHRPMT
TYRKEGDLRYSLEHVRQEFPEYGTTDFRHPAICLRQENGSRITDFVYVSHQIVDGKPALE
GLPATYTETQTEAKTLILTLRDEVTEVEVQLFYTIFADWPVIARSSKVINQGREACYLES
LASLSLDLPDADYNWLQLSGAWARERYIKERPLQQGIQSIESTRGISSPHHNPFVALKRP
ETTEFSGSVLGAALVYSGNFLIQAEVDTYDVARMQLGINPFGFEWKLAAGQSFTSPEALL
VYSERGLNGMSQVFHQLFRQRLARGYWRERARPVLINNWEATYFDFSENQLLELAEKAQE
VGVELFVLDDGWFGQRTNDRAGLGDWFVNPERLPKGLGSLAERIHGLGMQFGLWFEPEMV
NKDSQLYRTHPDWLLAVPDRQPHHGRNQFVLDYSRPEVVDEIFERLSAVIEEAQLDYIKW
DMNRPLTDVFSAAWPADQQGEIFHRYVLGVYDLYERLISRYPRLLFESCSSGGGRFDPGM
LYYAPQAWTSDDSDAIERLKIQYGTSLLYPLSSMGAHVSIVPNHQTNRLTPLKTRGNVAF
FGSFGYELDLNQLSPEELAEVREQIAFYKRHRDLIHNGTFYRLRSPFKGDGQTAWMVVSQ
DQNTALLGTFKVLNQVNRSHQRLQLKGLAADTVYRLEGRAYTGAELMRVGLVTTDASSGQ
LLEDSEQKPSYDFDSKLWLFEAEDE
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggcgagtatttggtttaaggaagagtgcaggcaatttcatctgactaacggt
gagatttcttatatctttcgggtttatgaggatggtaaactcttgcagctttactacgga
gcggtggtaccagagcgggattattcttatttggtggagctgcagcatcggcccatgacg
acctatcggaaagaaggagatttacgctattctttggagcatgtgcggcaggaatttcca
gaatacggcacgacagattttcgtcatcccgctatctgtctgcggcaggaaaatggctcg
cgtattactgattttgtctatgtcagtcatcagatagtagatggtaagcctgctttagag
gggctgcccgctacttatacagagactcaaacggaggctaagactcttattctaacccta
cgagatgaggtgacagaagtagaagttcagctgttttatacgatttttgctgattggccg
gttatcgctcgctctagcaaagtgattaatcaaggcagggaagcttgctatttggaatct
ctagctagtctgtcgctggatctgccagatgctgattataactggctgcagctatcagga
gcatgggctcgggaacgctatatcaaggagcgtccgcttcagcaggggattcagtctatt
gagtcaacccgcggcatttccagtccccaccacaatccctttgtggctcttaagcgaccg
gaaacgactgaattttcaggatcagtgctaggagctgctttggtgtattcaggtaatttt
ctcattcaggctgaggtggatacctatgatgtggcacggatgcagctaggcattaatcct
tttggttttgaatggaagctggctgcgggccagtcctttaccagtccagaggctctactg
gtttactctgagcggggcctcaacggcatgagtcaagtctttcatcagctatttcgtcaa
cgtctagctaggggctactggcgcgagcgagcgcgtcctgttctcatcaataactgggaa
gctacctattttgactttagtgagaatcagctgctggaacttgctgaaaaggctcaggaa
gtaggagtggagctctttgtgctagatgacggatggtttggccagcggactaacgatcgc
gctgggctgggggattggtttgttaatccagaaaggctgccgaaggggctgggctcgcta
gcagagcgtattcacggtttgggcatgcagtttggtctttggtttgagccggaaatggtc
aataaggacagccaactctaccgaactcatcctgactggctgctggcagtgccagataga
cagccccaccatggtcggaaccagtttgttttggactattctcggccggaagtagtggat
gagatttttgagcgtctatcagcggttatcgaggaagcgcagctggattatatcaaatgg
gatatgaatcgccctctgacggatgtcttctcagctgcttggccagccgatcagcaagga
gagatttttcaccgctatgtcttgggtgtttatgacttgtatgagcgtttaatcagtcgg
tatccgagactgttatttgagtcctgctcttcaggtggaggccgctttgatccaggtatg
ctctattatgctcctcaggcttggactagtgatgattcggatgctatcgagcgcttgaaa
atccagtacgggactagccttctctatccgctttcgtctatgggggctcatgtctccatc
gtgcccaatcaccagaccaatcgtctgactccgttgaagacgcggggcaatgtcgccttt
ttcggttcctttggctatgagctggatcttaatcagctaagcccagaggaattggctgaa
gtcagggaacagatagctttttacaagcgccatcgagatctgattcataatggaactttt
tatcgactgcggtcgccatttaagggagatggacagacagcttggatggttgtcagtcag
gatcagaacactgcacttttaggcactttcaaggtcctcaatcaagtcaatcgctctcat
cagcgtttgcaactgaaaggactggctgcggatacggtctatcggctagaggggcgtgcc
tatacgggggctgagcttatgcgagttgggctggtcaccacggacgcttccagcggtcag
cttctggaggattctgagcaaaagcctagctatgactttgattccaaactctggctgttt
gaagcagaggatgagtag

DBGET integrated database retrieval system