KEGG   Streptococcus sanguinis: SSA_0486Help
Entry
SSA_0486          CDS       T00473                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ssa  Streptococcus sanguinis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SSA_0486 (hemD)
Enzymes [BR:ssa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SSA_0486 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486777..487502
Genome map
AA seq 241 aa AA seqDB search
MVKKIIFTREQAPDSAWLEKIRQAGFETHHVPLIRCQSLPLPEAVQAILPEADWVFFTSA
VAVEAFSPYLKADYQIATIGPQTSQALDKLGRACDFQASSHYGLDFIQEWLDLALQTQKI
LLPQSSLSNPSLAEKLKEAGHEVWAWPMYATTSNPAGQDQLETYLSQEDVIWTFASPSAW
QSFCAIKPHLASSHQIAVIGQTTAQAVEESGYRVDYQPQSPSVEEMVKEIIKKEEKKHGI
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaaataatctttaccagagagcaggcgccagactctgcctggctagaaaag
atcagacaggctggatttgagacgcatcatgttcctctcattcgctgtcagtctttacct
ttgcctgaagctgtccaagcaattctgccagaagccgactgggtcttttttaccagtgct
gtcgcagtagaggctttcagtccctatctgaaagcggactaccagattgcgaccattggg
ccgcagaccagtcaggcgctggataagctgggccgagcctgtgattttcaggccagcagt
cactatggtcttgactttattcaggagtggctggatttggctctgcagacgcagaagatc
ttgctgccccagagtagcttgtccaatcccagtctggctgagaagttaaaagaagcaggt
catgaggtctgggcttggcctatgtacgcaacgacctcaaatcctgctggtcaggaccag
ctcgagacctatctgtcccaagaggatgtgatttggacctttgccagtccatcggcttgg
cagagtttttgtgctattaagccccatctagcatccagtcatcagattgcagtgattgga
cagacaacagctcaggcggttgaggagtccggctatagggtagattaccagccccagagt
ccttctgttgaggaaatggtcaaggaaataatcaagaaagaagagaagaagcatggaatt
ttatag

DBGET integrated database retrieval system