KEGG   Streptococcus sanguinis: SSA_0487Help
Entry
SSA_0487          CDS       T00473                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00860  Porphyrin and chlorophyll metabolism
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SSA_0487
Enzymes [BR:ssa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SSA_0487
Exosome [BR:ssa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSA_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 4806319
NCBI-ProteinID: YP_001034485
UniProt: A3CL80
Position
487489..488460
Genome map
AA seq 323 aa AA seqDB search
MEFYRHRRLRRSSGLRQLVRETKLSVDDFIQPLFVKEGLTEKQEVASMPGVYQFSLEDLL
PEVQECVNLGIRAFIVFGIPSEKDEIGSQASAENGIVQEAIRLIKKHFPETVVIADTCLC
EFTSHGHCGILRGEEVDNDLSLTRLTEVAVSQARAGADVIAPSNAMDGFVAAIRQGLDAA
GFEDIPIMSYAIKFASSFYGPFRDAGESAPAFGDRKTYQMDPANRLEALREAKSDEEQGA
DFLMVKPALAFLDILRELRQETQLPLVTYNVSGEYAMVKAAAQQGWINEKAIVMETLTSM
KRAGADLIITYFAKDAAGYLKEG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaattttatagacatcgcagactgaggagaagcagcggtctgcggcagctggttaga
gaaaccaagctgtctgtggatgattttatccaacccttgtttgtcaaggaaggcttgact
gaaaagcaagaagttgcctccatgccgggagtttatcagttctccctcgaggatttgctg
ccagaagttcaggaatgtgtgaacttgggcattcgggcttttatcgtctttggcattccg
tcagaaaaggacgaaataggcagccaggcttcagctgaaaatggcattgtacaggaagct
atccgtctgattaagaagcatttccctgagacggtcgtcattgcagacacctgtctctgt
gagtttaccagtcacggccattgcggtattttgcgaggggaggaagtggacaatgatctg
tctctgactagactgacagaagtcgctgtcagccaagccagggctggagcagatgtcatt
gcgccttccaatgccatggacggttttgtggcggctattcgtcaggggcttgatgcggct
ggctttgaagacattcccatcatgtcctatgcgattaagtttgcctctagcttttatgga
cctttccgagatgcaggtgagagtgctccggcctttggcgaccgcaagacctatcagatg
gatccggccaatcgcttggaggctctaagagaggccaagagcgatgaggagcagggagca
gactttctcatggttaagccggctctggcctttctggatatcctcagagagctgcgccag
gaaacccagctgcctctggtgacctataatgtcagtggagaatacgctatggtcaaggca
gcagcccagcagggctggatcaatgaaaaagccattgtcatggaaaccttgaccagtatg
aagcgggcaggtgcagacttgattatcacttattttgccaaggatgcggccggttatctg
aaagaaggatag

DBGET integrated database retrieval system