KEGG   Streptococcus sanguinis: SSA_0487Help
Entry
SSA_0487          CDS       T00473                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ssa  Streptococcus sanguinis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ssa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487489..488460
Genome map
AA seq 323 aa AA seqDB search
MEFYRHRRLRRSSGLRQLVRETKLSVDDFIQPLFVKEGLTEKQEVASMPGVYQFSLEDLL
PEVQECVNLGIRAFIVFGIPSEKDEIGSQASAENGIVQEAIRLIKKHFPETVVIADTCLC
EFTSHGHCGILRGEEVDNDLSLTRLTEVAVSQARAGADVIAPSNAMDGFVAAIRQGLDAA
GFEDIPIMSYAIKFASSFYGPFRDAGESAPAFGDRKTYQMDPANRLEALREAKSDEEQGA
DFLMVKPALAFLDILRELRQETQLPLVTYNVSGEYAMVKAAAQQGWINEKAIVMETLTSM
KRAGADLIITYFAKDAAGYLKEG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaattttatagacatcgcagactgaggagaagcagcggtctgcggcagctggttaga
gaaaccaagctgtctgtggatgattttatccaacccttgtttgtcaaggaaggcttgact
gaaaagcaagaagttgcctccatgccgggagtttatcagttctccctcgaggatttgctg
ccagaagttcaggaatgtgtgaacttgggcattcgggcttttatcgtctttggcattccg
tcagaaaaggacgaaataggcagccaggcttcagctgaaaatggcattgtacaggaagct
atccgtctgattaagaagcatttccctgagacggtcgtcattgcagacacctgtctctgt
gagtttaccagtcacggccattgcggtattttgcgaggggaggaagtggacaatgatctg
tctctgactagactgacagaagtcgctgtcagccaagccagggctggagcagatgtcatt
gcgccttccaatgccatggacggttttgtggcggctattcgtcaggggcttgatgcggct
ggctttgaagacattcccatcatgtcctatgcgattaagtttgcctctagcttttatgga
cctttccgagatgcaggtgagagtgctccggcctttggcgaccgcaagacctatcagatg
gatccggccaatcgcttggaggctctaagagaggccaagagcgatgaggagcagggagca
gactttctcatggttaagccggctctggcctttctggatatcctcagagagctgcgccag
gaaacccagctgcctctggtgacctataatgtcagtggagaatacgctatggtcaaggca
gcagcccagcagggctggatcaatgaaaaagccattgtcatggaaaccttgaccagtatg
aagcgggcaggtgcagacttgattatcacttattttgccaaggatgcggccggttatctg
aaagaaggatag

DBGET integrated database retrieval system