KEGG   Streptococcus sanguinis: SSA_0631Help
Entry
SSA_0631          CDS       T00473                                 

Gene name
trpB2
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSA_0631 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSA_0631 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSA_0631 (trpB2)
Enzymes [BR:ssa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSA_0631 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
620012..621193
Genome map
AA seq 393 aa AA seqDB search
MTETKGYFGQFGGSFVPEPIQALLDELEATFEKYKDDPEFLNEYRHYLTDYSGRETPLYY
AESLTQHLGGAKIYLKREDLNHLGSHKLNNVLGQILLAKRMGKTRVIAETGAGQHGVATA
AAAAKFGMKCDVYMGAEDVERQRLNVFRMEMMGATVHAVETGTKTLKDAVDAAFGAWMSD
LEAFYVLGSAVGPHPYPTIVHEFQKVISEESRRQILDKEGRLPDYVIACVGGGSNAIGAF
SQYVADEEVKLVGVEAAGRGLDTDQHAATMTKGSVGVVDGMKTYAVFAEDGQIAPVYSIS
AGLDYPGVGPEHAFFKDSGRVEYVAATDDEAVDALLLLTQKEGILPAIESSHAIAEAIKR
APKLSSDQIIIINVSGRGDKDVAAIADYLEKRK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaactaaaggatattttggacaatttggcggctcctttgtaccagagcctatc
caggccttgctggatgaattggaagcgacttttgagaagtataaggatgatccagaattt
ttaaatgaataccggcattatttgacggattattcaggtcgggagactccgctctactat
gcagaaagtctgacccagcacctgggcggagctaagatttatctgaagcgggaagatctc
aatcatctgggctctcacaagctcaataatgttttggggcagattttactagctaagcgc
atgggcaagactcgagtcattgctgaaactggagctggtcagcatggtgtggcaactgca
gcagccgcagctaagtttggtatgaagtgcgatgtttacatgggggcagaggatgtagag
cgccagcgccttaatgtcttccgcatggaaatgatgggagcgactgttcatgcagtggaa
acaggcaccaaaaccctcaaggatgcagttgatgcagcctttggagcttggatgagtgat
ttggaagccttctatgtcttgggctcagctgtcggtcctcacccctatccaacgattgtc
catgagttccaaaaggtgattagtgaagaatctcgccggcagattttggacaaggaaggc
cgcttgccagactatgtcattgcctgtgtaggcggtggctccaatgctatcggcgctttc
tctcagtatgtggcggatgaagaagtcaagctggttggtgttgaagcggctggacggggt
cttgatacagaccagcatgcagcgaccatgaccaagggaagcgtcggagtagtggacggt
atgaagacctacgctgtctttgctgaagatgggcagatagcgccggtttactcgatttca
gcaggcttggactatcctggagttggtcctgaacatgctttctttaaagattccggccga
gtagaatacgtggcagcgacagatgatgaagctgtggacgctttgcttctcttgacgcaa
aaggaaggaattttgccagcaatcgaaagctctcatgccattgctgaagccatcaagcga
gctccaaaattgtcatctgatcaaatcatcattatcaatgtatctggtcgtggagacaag
gatgtggcagccattgccgactatctagaaaaacgaaaataa

DBGET integrated database retrieval system