KEGG   Streptococcus sanguinis: SSA_0637Help
Entry
SSA_0637          CDS       T00473                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00260  Glycine, serine and threonine metabolism
ssa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01130  Biosynthesis of antibiotics
ssa01230  Biosynthesis of amino acids
Module
ssa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSA_0637 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSA_0637 (trpB)
Enzymes [BR:ssa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSA_0637 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 4806389
NCBI-ProteinID: YP_001034626
UniProt: A3CLM1
Position
625859..627082
Genome map
AA seq 407 aa AA seqDB search
MAYNQPNQEGFYGEFGGRFVPETLMTAVLELDKAYRESKKDPAFQAELDELLKQYVGREN
PLYFAKNLTAYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFNMDCTIYMGEEDVKRQALNVFRMELLGAKVESVTDGSRVLKDAVNAALRA
WVAQVDDTHYIMGSALGPHPFPEIVRDYQSVIGREAKRQFAEQNAGALPDALVACVGGGS
NAIGLFYPFVDDSTVAMYGTEAAGRGVDTDEHAATLTKGRPGVLHGALMDVLQDEQGQIL
EAFSISAGLDYPGIGPEHSHFNAIQRATYVPVTDEEALEAFQLLSRIEGIIPALESSHAI
AYAVKLAKELGPDKSMIVCLSGRGDKDVVQVKERLERETAQKGGAHD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatataatcaacccaatcaagaaggattttacggtgagtttggtgggcgctttgtt
cccgaaacgctgatgacagcagttttggagctagacaaagcctaccgtgagagtaaaaaa
gacccagcctttcaggctgagctggacgagttgctaaagcagtatgtagggcgagaaaat
cctctctattttgctaaaaatctgacagcctatgctggcggtgctaagatttatctgaag
cgggaagacctcaaccataccggggcacataaaatcaataatgccctaggtcaggtccta
ttagccaagcgaatgggcaagaagaaaattattgcggagactggtgcgggtcagcacggg
gtagccacagccacagctgcagcccttttcaacatggactgtaccatttacatgggcgaa
gaagatgtcaagcgccaagccctcaatgtctttcggatggaacttcttggagccaaggtg
gagtctgtgaccgatggctctcgagtcctcaaagatgcggtcaatgcagctttacgagct
tgggtggctcaggtcgatgatactcactatattatggggtcggccttgggaccccatccc
ttcccagagattgtccgcgactatcagagtgtgattggtcgtgaggctaagcgccagttt
gctgagcaaaatgcaggtgccctgccagatgctttagtcgcctgcgttggcggtggttcc
aatgctattgggctcttttatccctttgtagatgatagtacagtggctatgtatggaaca
gaagcagctgggcggggcgtggatacagatgaacacgctgcgaccttaaccaagggccgg
ccgggtgttttgcacggtgccttgatggatgtcttgcaggatgagcaaggacagattctg
gaagctttctctatctctgccgggctggactatccgggcatcggtcctgaacattctcat
tttaatgctatccagcgcgccacttatgtgccagtcacggatgaagaagccttggaagcc
ttccagcttttgtctcgtattgaagggattatccctgctctagagtctagccacgctatt
gcttacgcagttaagctggctaaggagttgggaccagataaatcaatgattgtctgccta
tccggccgtggtgacaaggatgtcgttcaggtaaaggaacgcttggaaagagaaacggct
caaaaaggaggtgcccatgactaa

DBGET integrated database retrieval system