KEGG   Streptococcus sanguinis: SSA_0638Help
Entry
SSA_0638          CDS       T00473                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSA_0638 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSA_0638 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSA_0638 (trpA)
Enzymes [BR:ssa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSA_0638 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
627075..627854
Genome map
AA seq 259 aa AA seqDB search
MTKTLTQHLETIKREGKGIFLPYIMAGDHEKGLAGLPETIAFLENLGVSAIEIGLPFSDP
VADGPVIEEAGLRSLGHHTSAKSLIASLQKLDTQLPLIIMTYFNPIFQYGLKDFIKDLAR
TPVKGLIIPDLPYEHRDFILPLLEDSDIALVPLVSLTTGLERQQELIKEAEGFIYAVAIN
GVTGKSGSYRNDLDQHLSKLHDIAEIPVLTGFGVSTLEDVDRFNQVSDGVIVGSKIVKAL
HEKDASIAAFIQEAAAYKK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacactcactcagcatttagaaaccatcaaaagagaaggcaagggaattttc
cttccttatattatggctggtgatcacgagaaaggtttagccggattaccagaaactatc
gcatttttggaaaacttgggtgtgtcagccattgaaatcggcctgccattttcagaccct
gttgcagatgggccggttattgaagaagccggtctgagaagtctgggtcaccatacttcg
gccaagtctttaatcgcaagcttgcagaagttggacactcagctgcctctcatcatcatg
acctacttcaatcctatcttccagtacggtctcaaagattttatcaaggatttggctagg
acgccggttaagggattgattattccggatctgccctacgagcatagggactttatcctg
cctctgctggaagattcagatatcgctctagttcctttagtgagccttacgactggacta
gaacgtcagcaggagctaattaaggaggcagaaggttttatctacgctgtagccatcaac
ggtgtaacgggtaagagcggaagctaccgcaatgatttggaccagcatttgagcaagctc
catgatattgctgagattccagtgctgacaggttttggcgtttcaactttagaggatgtt
gatcgcttcaatcaagtctcagacggagtcattgtcggatctaagattgtcaaagctctt
catgaaaaggacgccagtatagcggcctttatccaagaagcagcagcttataagaaataa

DBGET integrated database retrieval system