KEGG   Streptococcus sanguinis: SSA_0847Help
Entry
SSA_0847          CDS       T00473                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSA_0847 (pfk)
   01230 Biosynthesis of amino acids
    SSA_0847 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_0847 (pfk)
   00030 Pentose phosphate pathway
    SSA_0847 (pfk)
   00051 Fructose and mannose metabolism
    SSA_0847 (pfk)
   00052 Galactose metabolism
    SSA_0847 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SSA_0847 (pfk)
Enzymes [BR:ssa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSA_0847 (pfk)
Protein phosphatases and associated proteins [BR:ssa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSA_0847 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833512..834522
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGIYDGYAGMVAGEIYPLDATSVGDI
ISRGGTFLHSARYPEFAQVEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIASGADEIIVPEEGFKIEEVVESIKNGYAKGKKHNIIVLAEGVMSADEFAEKLKEAGDM
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEQMVESPILGT
AEEGALFSLTAEGKIVVNNPHKADLDLADLNRSINI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggtggtgatgcccctggtatgaatgctgccatc
cgtgcggttgttcgtaaagcaatttccgaaggaatggaagtttacggtatttatgatggt
tacgctggaatggtagctggcgagatttacccacttgatgcgacatcagttggtgacatt
atttctcgcggtggaactttccttcactctgctcgttatcctgagtttgcccaagttgaa
gggcagctgaaagggattgagcaacttaaaaaacatggaattgaaggtgtcgttgttatc
ggtggtgatggatcttaccacggtgcgatgcgcttgacagagcatggcttcccagctgtt
ggtgttccaggaaccattgataatgatatcgtcggaacagacttcactatcggttttgat
actgctgttactacagctatggatgcgattgacaagattcgggatacctcatccagtcac
cgccgtactttcgttatcgaagtaatgggccgtaatgctggtgatattgctctttgggca
ggtattgcatctggtgcggacgaaatcatcgttcctgaagaaggtttcaagatcgaagaa
gttgttgaaagcattaagaatggctatgccaagggtaagaaacacaacatcatcgtcttg
gctgagggtgtcatgtcagcggatgaatttgctgagaagctgaaagaagctggcgatatg
agcgacttgcgtgtcacagagctcggacatatccagcgtggaggctcaccgactgcgcgt
gatcgtgttcttgcatctcgtatgggagcacatgctgttaaactgcttaaagaaggtatc
ggcggagttgctgttggaatccgcaatgagcagatggttgaaagcccaattctgggaact
gctgaagaaggagcactctttagcttgactgctgaaggcaagattgttgtcaataatccg
cacaaggctgatctggacttggctgatttgaaccgcagcatcaatatttaa

DBGET integrated database retrieval system