KEGG   Streptococcus sanguinis: SSA_0859Help
Entry
SSA_0859          CDS       T00473                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSA_0859 (tpiA)
   01230 Biosynthesis of amino acids
    SSA_0859 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_0859 (tpiA)
   00051 Fructose and mannose metabolism
    SSA_0859 (tpiA)
   00562 Inositol phosphate metabolism
    SSA_0859 (tpiA)
Enzymes [BR:ssa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSA_0859 (tpiA)
Exosome [BR:ssa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSA_0859 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSA_0859 (tpiA)
  Exosomal proteins of melanoma cells
   SSA_0859 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846781..847545
Genome map
AA seq 254 aa AA seqDB search
MNMSRKPFIAGNWKMNKNPEEAKAFVEAVAAKLPSSDLVEAGIAAPALDLTTVLAAAKGS
NLKVAAQNAYFEDAGAFTGENSPKVLAEVGVDYIVIGHSERRDYFHETDQDINKKAHAIF
RNGLVPIICCGESLETYEAGKAVDFVGAQVSAALKDLTAEQVASLVIAYEPIWAIGTGKS
ATQDDAQKMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGAS
LEAESFLALLDFVK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatgtcacgtaaaccatttattgctggtaactggaaaatgaacaaaaatcctgaa
gaagcaaaggcttttgtagaagcggttgctgctaagctaccttcttcagatttagtagaa
gctggtatcgctgctccagcacttgatttgacaactgttttggcagcagctaaaggaagc
aatcttaaggttgcagcgcaaaatgcttactttgaagatgcaggtgctttcactggtgaa
aacagccctaaagttcttgcagaagttggagttgactacattgttatcggtcactcagaa
cgccgcgattatttccatgaaacagaccaagacatcaacaaaaaagcgcacgctatcttc
cgcaatggtctggtgccaatcatctgctgtggtgagtcgcttgaaacttacgaagctggt
aaagctgtagatttcgttggtgctcaagtatcagctgctttgaaagacttgacagctgag
caagttgcatcattggttatcgcttatgagccaatctgggctatcggtactggtaagtca
gcaactcaagacgacgctcaaaagatgtgtaaagcagttcgtgacgttgtagcagctgac
tttggtcaagaagtagcggacaaggttcgcgttcagtacggcggttctgtaaaacctgaa
aatgttgcgtcttacatggcttgtccagatgttgacggtgctcttgttggtggtgcatca
cttgaagctgaaagcttcttggcattgcttgattttgtaaaataa

DBGET integrated database retrieval system