KEGG   Streptococcus sanguinis: SSA_0921Help
Entry
SSA_0921          CDS       T00473                                 

Gene name
adhB
Definition
Zn-dependeant threonine dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSA_0921 (adhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_0921 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    SSA_0921 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSA_0921 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSA_0921 (adhB)
   00626 Naphthalene degradation
    SSA_0921 (adhB)
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSA_0921 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
931187..932224
Genome map
AA seq 345 aa AA seqDB search
MKLAVYTKAGQVGLADLDRPQIIEADDAIIRIVRTCVCGSDLWRYRSPDIEAGHQNSGHE
AIGIVEEIGDTVTTVKPGDFVIAPFTHGCGQCDACRAGFDGTCDSHIGNNWSDGVQAEYM
RFEFANWALIKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVADVKPGDKVVVIGDGAV
GQCAVIAAKMRGASQIVLMSRHEDRQKMALESGATAVVAERGEEGIAKVREILGGGADAA
LECVGTEAAVDQALGVLHNGGRLGFVGVPHYNNRALGSTFAQNITVAGGAASVTTYDKQI
LLKAVLDGDINPGRVFTSSYKLEDIDQAYRDMDERKTIKSMIVFD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggcagtttatacaaaagcgggccaagttgggctcgctgaccttgaccgtccg
caaatcattgaggcagatgatgccattattcggattgttcgaacctgtgtctgtggatct
gacttatggcgctaccgcagtccagatattgaagcaggccatcaaaatagcgggcatgaa
gcgattggaattgtcgaagaaatcggagatacagtaacgactgttaaacctggtgacttc
gttatcgcacctttcactcatggatgcgggcaatgtgatgcctgtcgggcaggattcgac
ggcacttgtgattctcatattgggaataactggtcagatggggtgcaagcagaatatatg
cgcttcgaatttgctaactgggcacttatcaaaattccgggccagccctctgattataca
gaaggtatgctcaaatccctcttgacactggctgatgtcatgccaactggctatcatgct
gcacgagtggcagatgttaagcctggtgataaggtggtcgttattggcgacggagctgtt
gggcaatgcgctgtgattgctgctaaaatgcgtggtgcttcccaaatcgttctcatgagc
cgacacgaagatcgacaaaaaatggccttggaatcaggtgcgacagctgttgttgcagaa
cgtggcgaagaaggaattgccaaggttcgtgagattctaggtggcggggcagatgcagct
ctagaatgcgtcggaacagaagcagctgttgatcaagctctaggagtcctgcacaacggc
ggccgcttgggctttgtcggtgtgcctcactataataaccgagctcttggttctaccttt
gctcaaaatattacagtggcaggaggagcagcctctgtcacgacttacgacaagcaaatc
ttgctcaaggcagttcttgatggtgatattaatccaggtcgcgtctttacttcaagctac
aaactagaagatattgatcaagcttatagagacatggatgagcgcaagaccattaagtcc
atgattgtctttgattag

DBGET integrated database retrieval system