KEGG   Streptococcus sanguinis: SSA_0921Help
Entry
SSA_0921          CDS       T00473                                 

Gene name
adhB
Definition
Zn-dependeant threonine dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ssa  Streptococcus sanguinis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSA_0921 (adhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSA_0921 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    SSA_0921 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSA_0921 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSA_0921 (adhB)
   00626 Naphthalene degradation
    SSA_0921 (adhB)
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSA_0921 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
931187..932224
Genome map
AA seq 345 aa AA seqDB search
MKLAVYTKAGQVGLADLDRPQIIEADDAIIRIVRTCVCGSDLWRYRSPDIEAGHQNSGHE
AIGIVEEIGDTVTTVKPGDFVIAPFTHGCGQCDACRAGFDGTCDSHIGNNWSDGVQAEYM
RFEFANWALIKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVADVKPGDKVVVIGDGAV
GQCAVIAAKMRGASQIVLMSRHEDRQKMALESGATAVVAERGEEGIAKVREILGGGADAA
LECVGTEAAVDQALGVLHNGGRLGFVGVPHYNNRALGSTFAQNITVAGGAASVTTYDKQI
LLKAVLDGDINPGRVFTSSYKLEDIDQAYRDMDERKTIKSMIVFD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggcagtttatacaaaagcgggccaagttgggctcgctgaccttgaccgtccg
caaatcattgaggcagatgatgccattattcggattgttcgaacctgtgtctgtggatct
gacttatggcgctaccgcagtccagatattgaagcaggccatcaaaatagcgggcatgaa
gcgattggaattgtcgaagaaatcggagatacagtaacgactgttaaacctggtgacttc
gttatcgcacctttcactcatggatgcgggcaatgtgatgcctgtcgggcaggattcgac
ggcacttgtgattctcatattgggaataactggtcagatggggtgcaagcagaatatatg
cgcttcgaatttgctaactgggcacttatcaaaattccgggccagccctctgattataca
gaaggtatgctcaaatccctcttgacactggctgatgtcatgccaactggctatcatgct
gcacgagtggcagatgttaagcctggtgataaggtggtcgttattggcgacggagctgtt
gggcaatgcgctgtgattgctgctaaaatgcgtggtgcttcccaaatcgttctcatgagc
cgacacgaagatcgacaaaaaatggccttggaatcaggtgcgacagctgttgttgcagaa
cgtggcgaagaaggaattgccaaggttcgtgagattctaggtggcggggcagatgcagct
ctagaatgcgtcggaacagaagcagctgttgatcaagctctaggagtcctgcacaacggc
ggccgcttgggctttgtcggtgtgcctcactataataaccgagctcttggttctaccttt
gctcaaaatattacagtggcaggaggagcagcctctgtcacgacttacgacaagcaaatc
ttgctcaaggcagttcttgatggtgatattaatccaggtcgcgtctttacttcaagctac
aaactagaagatattgatcaagcttatagagacatggatgagcgcaagaccattaagtcc
atgattgtctttgattag

DBGET integrated database retrieval system