KEGG   Streptococcus sanguinis: SSA_1002Help
Entry
SSA_1002          CDS       T00473                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssa  Streptococcus sanguinis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ssa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ssa00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001840..1004002
Genome map
AA seq 720 aa AA seqDB search
MAIKIDKHLFYINTKNSSLIIEERDGYLLLKHLGRKIESYHFSNTVFERDHAFSGNPRSN
ERSFSLDTQRQVLGQHGLGDFRQPSLQVQHANNEVTDFRFVESQLIKGGLEVPGLPSPHS
TEDAETLAFILEDTVAHLRLTLYYTAFEDSNTIATFTKLENIGRETAVIHKNLSLMADLP
AGTYDVISLQGAYAREKTVRRHKLEQGIFKIASNRGASGHTQTPSLILCDSETTEEAGQV
WAIQLLYSGNFEAWIQQNQLNEVRLGIGINEDNFAWKLEARQTFYSPVALLNYSAQGLTG
LSHESQAFVQEHIIPKAFAKRERPILINNWEATYFDFKKEKLLELADEAQKVGIELFVLD
DGWFGNRFDDNRALGDWFVNEDKLGGSLTELISEVHSRGLQFGLWVEPEMISVDSQLYRA
HPDWAIQAPDRDHTYSRNQLVLDYANPDVVAYIKETLDQLLSQHDIDYIKWDMNRNITNL
GNGTNYLATKMQSHKYILGLYEIVKYLTEKYENILFESCSGGGGRNDLGMMRYFPQVWAS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRITPLATRGHVAMMGNLGYELDL
TSLSDEEKAAIADQVKLYKELRPVVQLGRQYRLINPDVGSNEAAVQFNYEDQTIVTYVRV
LSVVETMETTLKLKDLEEEGLYELQGNGAVYSGAELMYAGITMNLPQGDYLSRQLHFIKK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaaatagacaaacatctattctacatcaatacaaaaaattccagtcttatc
attgaggaaagggatggctaccttttgcttaaacacttaggcagaaaaatcgaatcctat
catttttccaatacagtatttgagcgagatcatgcattttctggtaatccgaggtcgaat
gagcggagttttagcttagatacccagcggcaggttttgggtcagcatggtttaggagac
tttcggcaaccttctctgcaagtccaacatgctaataatgaagtaacagattttaggttt
gttgagagtcagctgattaagggaggtttggaagttccaggactgcctagccctcacagt
acagaagatgcagaaacactggcctttattttagaggatacagtagctcacttacgcctc
actctctattacacagcttttgaagatagcaataccattgcaacctttactaagctggaa
aatatcggtagagagacagcagtcatacataagaacttgagcttaatggcagatttacca
gcagggacttatgatgtgattagtttacagggagcttatgctagggagaaaacagttcgt
cgtcacaagctagaacagggaattttcaaaatagcttccaaccgaggagcttctggtcac
acgcagactccgagccttatcctttgtgatagtgaaacgacggaagaggctggtcaagtt
tgggcaattcagctcctttatagcggaaactttgaagcttggattcagcaaaatcagttg
aatgaagttcggctaggtatcggtatcaatgaagataactttgcttggaaactggaagcg
aggcagactttctatagtcctgttgctctgttgaattattcggctcagggtttgactggt
cttagtcatgagagccaagcttttgttcaagagcatatcattcctaaagcatttgcgaag
cgagagcggccaattttaatcaataactgggaagcaacttactttgatttcaaaaaagag
aagttgctagagttagcagatgaggcgcagaaagttggtattgagctctttgttctcgat
gatggctggtttggcaaccgttttgatgacaatcgggctctgggcgactggtttgtcaat
gaagataagctaggcggcagtttgacggagctcatatcagaagttcatagcagaggattg
caatttggtttatgggttgagccagaaatgatttccgtagacagtcagctttatcgggca
catccagactgggctattcaagcgcctgatcgggatcatacctactctcgcaatcaactc
gtattggattatgctaatccagatgtggtagcctatatcaaagaaacactggatcagctg
ttgagtcagcacgatattgactacataaaatgggatatgaatcgtaatattaccaatctt
gggaatggcactaactatctggcgaccaaaatgcagtcgcataagtatatcttggggctt
tatgaaattgtaaaatatttgacagagaaatatgagaatattttatttgagtcctgctca
ggtggtggtggacgaaatgatcttggtatgatgcggtatttccctcaagtttgggctagt
gacaataccgatgccatagctcgtttgccaatccaatatgggtcttcttatctttatccg
actatttcaatgggtgcccatgtgtcggcagtgcctaatcatcagatgggacgaattact
ccgctggcaactcggggtcatgtagctatgatgggaaatctggggtatgagcttgatttg
actagtctatcagatgaagagaaagctgcgattgctgaccaggtgaagttgtataaagaa
ttacggccagtggtccagctagggcgtcagtataggctaatcaatccagatgttggctcc
aatgaagcagcagttcaatttaactatgaagatcaaacgattgtaacctacgtccgagtc
ttatcagttgtggaaacgatggaaacaaccttgaaactaaaagacttagaggaagaaggg
ctttatgagctgcagggaaatggcgcagtttactcaggtgcagaactcatgtatgctggt
atcactatgaatcttccgcaaggagattatcttagcagacagttgcattttattaaaaaa
taa

DBGET integrated database retrieval system