KEGG   Streptococcus sanguinis: SSA_1006Help
Entry
SSA_1006          CDS       T00473                                 

Gene name
gtfA
Definition
dextransucrase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ssa  Streptococcus sanguinis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSA_1006 (gtfA)
Enzymes [BR:ssa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SSA_1006 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1007216..1008661
Genome map
AA seq 481 aa AA seqDB search
MAIQNKTMLITYSDSLGENLKDLYDNLEKHFGDAVGGVHLLPFFPSTGDRGFAPVDYEEV
DSAFGDWEDVEKLGEKYYLMFDFMINHISRQSKYYMDFQEKKDQSEYRDLFLSWDKFWPE
NRPTQADVDLIYKRKDRAPKQEIVFADGSTEYLWNTFGEEQIDLDVRSQVTNDFIKKTLR
QLSEHGCDLIRLDAFAYAVKKLDTNDFFVEPEIWDLLEKVQQQAAEFGTDILPEIHEHYS
IQFKIAEHGYFVYDFALPMVTLYSLYSGKAERLVKWLEMSPMKQFTTLDTHDGIGVVDVK
DILSDEEIDFATNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDKKYFISRLI
QAFAPGIPQVYYVGFLAGKNDLELLENTKEGRNINRHYYSNEEIAEEVKRPVVQALLKLF
NYRNQSAAFDLDGTIEVNLLDENSLRIVRSNANKSVTAQVVINLKELTYSASENGQAITF
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctattcaaaataagaccatgctgattacttactcagacagcttgggggagaattta
aaagatttatatgacaatttagaaaagcattttggggatgcggttggaggagtgcatttg
cttcctttcttcccatcaactggtgaccggggattcgccccagtagactatgaagaggtt
gattcagcctttggtgactgggaggatgtagaaaagctgggcgagaaatattatctcatg
tttgactttatgatcaaccacatctcacgccagtctaagtattatatggattttcaggaa
aagaaggatcagagtgagtatcgtgacctctttctcagctgggataagttttggccagaa
aatcgtccgacgcaagctgatgttgatttgatttataagcgtaaggatcgggcacctaag
caggaaatcgtctttgcagatggaagcactgagtatttgtggaacacctttggtgaagag
cagattgatctagatgttcgcagtcaggtaactaatgatttcatcaagaaaacattgcgt
caactgtcagagcatggctgtgatctgattcgtttagatgcatttgcctatgcggtcaaa
aagttagataccaatgatttctttgttgagccagaaatctgggatctcttagaaaaagtc
cagcagcaagcggctgagtttgggacggatattttaccagaaattcatgagcattattct
atccagttcaagattgcagagcatggctactttgtctatgattttgcgctgccgatggta
actctttattctctatacagtggtaaagctgagcgtctagtcaagtggcttgaaatgagt
cctatgaagcaattcacaacactggatactcacgatggtattggggttgttgatgttaag
gatattctgtctgatgaagaaattgactttgcgaccaatgaactatataaggtcggggct
aatgtcaagcgtaagtattcctcagctgagtacaataatctggacatttaccagattaac
tcgacttactactcagccttgggcgatgacgacaagaagtacttcattagccgtctgatt
caggcttttgctccagggattccacaggtctattatgttggtttcttagctgggaaaaat
gaccttgaactgctagaaaacactaaggaaggccgcaatatcaaccgtcattattacagt
aatgaggagattgctgaagaagtcaagcgtccagttgtgcaagccttgctcaagcttttc
aattaccgcaaccagtctgctgcctttgacctagatggcactattgaagtgaatctattg
gatgaaaatagcctccggattgtccgtagcaatgcaaataagtcagtcactgctcaagta
gttataaacctcaaagaattgacatatagcgctagtgaaaatggccaagctatcactttt
gaatag

DBGET integrated database retrieval system